KEGG   Enhydra lutris kenyoni (northern sea otter): 111153538
Entry
111153538         CDS       T05871                                 

Definition
(RefSeq) tyrosine-protein kinase SYK isoform X1
  KO
K05855  spleen tyrosine kinase [EC:2.7.10.2]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04064  NF-kappa B signaling pathway
elk04072  Phospholipase D signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04380  Osteoclast differentiation
elk04611  Platelet activation
elk04625  C-type lectin receptor signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk04662  B cell receptor signaling pathway
elk04664  Fc epsilon RI signaling pathway
elk04666  Fc gamma R-mediated phagocytosis
elk05152  Tuberculosis
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05171  Coronavirus disease - COVID-19
elk05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    111153538
   04072 Phospholipase D signaling pathway
    111153538
   04151 PI3K-Akt signaling pathway
    111153538
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111153538
   04625 C-type lectin receptor signaling pathway
    111153538
   04650 Natural killer cell mediated cytotoxicity
    111153538
   04662 B cell receptor signaling pathway
    111153538
   04664 Fc epsilon RI signaling pathway
    111153538
   04666 Fc gamma R-mediated phagocytosis
    111153538
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111153538
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111153538
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111153538
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    111153538
   05168 Herpes simplex virus 1 infection
    111153538
   05167 Kaposi sarcoma-associated herpesvirus infection
    111153538
   05169 Epstein-Barr virus infection
    111153538
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111153538
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     111153538
Protein kinases [BR:elk01001]
 Non-receptor tyrosine kinases
  SYK family
   111153538
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 Kdo RIO1
Other DBs
NCBI-GeneID: 111153538
NCBI-ProteinID: XP_022368311
UniProt: A0A2Y9K4U3
LinkDB
Position
Unknown
AA seq 635 aa
MAGSAADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRKA
HHYTIEREMNGTYAIAGGRTHGSPAELCHYHSQESDGLVCLLTKPFPRPPGVQPKTGPFE
DLKESLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISRVESEQI
VMIGSKTNGKFLIRDRNDNGSYALCVLHEGKVLHYRIDKDKTGKLSIPDGKKFDTLWQLV
EHYSYKPDGLLRVLTVPCQKIGGQTGNINFGARAPLPGANPATWSAGGIISRIKSYSFPK
PGHRKASSSAGSRPESSVTFNPYEPDRGPWATDRDAQREAMPMDTEVYESPYADPEEIRP
KEVYLDRKLLTLEDSELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAE
ANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSM
GMKYLEECNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYA
PECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVSAMLEKGERMGCPAGCPRE
MYELMKLCWTYEVEKRPSFENVELRLRNYYYDVVN
NT seq 1908 nt   +upstreamnt  +downstreamnt
atggcggggagcgcggccgacagtgccaaccacctgcccttcttcttcggcaacatcacc
cgggaggaggctgaggactacctggtccagggcggcatgagcgacgggctgtacctgctg
cggcagagccggaactacctgggcggcttcgcgctgtcggtggcgcacggcaggaaggcg
caccactacaccatcgagcgcgagatgaacggcacctacgccatcgcgggcggcaggacg
cacggcagcccggccgagctctgccactaccactcgcaggagtccgacggcctggtctgc
ctcctcaccaagcccttcccccgtccgcccggggtgcagcccaagacaggccccttcgag
gacctgaaggagagcctcatccgcgagtacgtgaagcagacctggaacctgcagggccag
gctctggagcaggccatcatcagccagaagccgcagctggagaagctgatcgccaccaca
gcccacgagaagatgccttggttccatgggaagatctcaagggttgagtctgagcagatc
gtcatgataggatccaagacaaacggaaagtttttgatcagggacaggaacgacaacggg
tcatacgccctgtgtgtgctgcatgaggggaaagtgcttcactaccggatcgacaaggac
aagacgggcaagctctccatccccgacgggaagaagttcgacacactctggcagctggtg
gagcattactcttacaaacccgatggactgctgagagttctcacagttccgtgccagaag
atcggcgggcagacagggaacatcaacttcggagcccgcgcgcccctcccgggagccaat
cctgccacgtggtcggcgggtggaataatttccagaatcaaatcgtactccttccccaag
cccggccacagaaaggcctcctcgtccgcagggagccggcccgagagctccgtgaccttc
aatccttacgagccagaccgggggccctgggccacggacagagatgcccagagagaagcc
atgcccatggacaccgaggtgtacgagagcccctacgccgaccccgaggagatccggccc
aaggaggtctacctggaccgcaagctgctgaccctggaggacagtgagctgggctccggc
aacttcgggaccgtgaagaagggctactaccagatgaaaaaagtcgtgaagacggtggcc
gtgaagattctgaagaacgaggctaatgatcccgcccttaaagacgagttgttggcagaa
gcgaacgtcatgcagcagctggataacccgtacatcgtgcgcatgatcggaatatgtgag
gccgagtcctggatgctggtcatggagatggccgagctcggtccgctcaacaagtactta
cagcagaacaggcacgtcaaggacaagaacatcatagaactggttcaccaggtttctatg
gggatgaagtacttggaggagtgcaacttcgtgcacagggatctggcggcaagaaacgta
ctgctggtgacgcaacattatgccaagatcagtgatttcggactgtccaaagcactccgt
gctgacgaaaactactataaggcccagacgcacgggaagtggccggtgaagtggtacgct
cccgagtgcatcaactactacaagttctccagcaagagcgacgtctggagcttcggtgtg
ttgatgtgggaggcgttctcctacgggcagaagccctaccggggcatgaaaggaagtgaa
gtttcggctatgctggagaaaggggagaggatggggtgccccgcgggatgtccgagggag
atgtacgagctgatgaagctgtgctggacatatgaggtggagaagaggccgagtttcgaa
aatgtggagctgcggctgcgcaattattactacgacgtggtgaactaa

DBGET integrated database retrieval system