KEGG   Enhydra lutris kenyoni (northern sea otter): 111153730
Entry
111153730         CDS       T05871                                 

Definition
(RefSeq) serine-protein kinase ATM isoform X1
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01524  Platinum drug resistance
elk03440  Homologous recombination
elk04064  NF-kappa B signaling pathway
elk04068  FoxO signaling pathway
elk04110  Cell cycle
elk04115  p53 signaling pathway
elk04210  Apoptosis
elk04218  Cellular senescence
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05170  Human immunodeficiency virus 1 infection
elk05202  Transcriptional misregulation in cancer
elk05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    111153730
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    111153730
   04068 FoxO signaling pathway
    111153730
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111153730
   04210 Apoptosis
    111153730
   04115 p53 signaling pathway
    111153730
   04218 Cellular senescence
    111153730
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    111153730
   05206 MicroRNAs in cancer
    111153730
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111153730
   05170 Human immunodeficiency virus 1 infection
    111153730
   05165 Human papillomavirus infection
    111153730
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111153730
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111153730
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:elk03032]
    111153730
   03400 DNA repair and recombination proteins [BR:elk03400]
    111153730
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111153730
Protein kinases [BR:elk01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   111153730
DNA replication proteins [BR:elk03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     111153730
DNA repair and recombination proteins [BR:elk03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    111153730
SSDB
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC
Other DBs
NCBI-GeneID: 111153730
NCBI-ProteinID: XP_022368621
UniProt: A0A2Y9K5J3
LinkDB
Position
Unknown
AA seq 3057 aa
MSLALNDLLICCRQLEHDRATERRKEVEKFKRLIRDPETVQHLDRHSDSKQSKYLNWDAV
FRFLQKYVQKETECLRTAKPSVSASTQATRQKKMQEISSLVKYFIKCANKRAPRLKCQEL
LNYIMDTVKDSSNGSIYGADCSNILLKDVLSVRKYWCEISQQQWLELFSVYFSLYLKPAQ
DINRVLVARIIHAVTKGCCSQTDGLNSKFLDFFSKAIQHARQEKGSAGLNHILAAFVIFL
KTLAVNFRIRVCQLGDEILPALLYIWTQHRLNDSLKEVIIELLQLQIYVHHPKGAKTQEK
GAYESSKWRSILYNLYDLLINEISHIGSRGKYSSGSRNVAVKENLIELMADICHQIFNED
TRSLEISQSYTTTQRECNDYSAPCKKKKIQLGWEVIKDHLQKSQSDFDLVPWLQITTQLI
SKYPSSLPNYELSPLLMILYQLLPQHRHGERTPYVLRCLTEVALCQGKKSNLEGSQKSDL
LKFWIKIWSLTFRGISSEQIQAENFGLLGAIIQGSLIEVDREFWKLFTGSACRPSRPAVC
CLTLAMAICGVPETVKTGVEQSICEVNRSCSLKELIMRRLLLSQLEDDLEDRTELPPVLH
SNFPHLAVEKILVSLTVKNCKAAMNFLQRVPECEQHQKVQEEPSFSEVEELFLQTTFDKM
DFLTIVKECAVEKHQATVGFSVHQNLKESLDRYLLGLSEQLLNNYSPETTNAETLIRCSS
LLVGVLGCYCYVGVVAEEEAYRSELFQKAKSLMQCAGESITLFKNKTYEESRVASLRNVM
TLCTGCLCNCTKPSPNKIASRFFLRLLTSKLMNDIADICRSLASFIRKPLDLGEVESMED
DPDENLMEVEDQSSMHLFSDAPACGTSDAAVSGDSGSTFGAMNPLAEEHLSKQDLLFLDM
LKFLCVCTTTAQTGTVSFRAADIRRKLLMLVDTSMLDPAKSLHLRMYLVLLKELPGEEYP
LPIEEVFELLKPLSNVCSLYRRDQDVCRTVLNHLVPVVRNLCQGDMDAENTRDAQGQLLT
VIGAFWHLAKEGKCTFSVRMALVKCLKTLLETDPYSKWAVLNVMGKDFPVNEVFPHFLGD
RHHQVSMLAAESVNRLFQDMKHRGSSTLLKALPLKLQQTAFENAYLKALEGMREVSHRAE
NPELLDEIYNRKSVLLMTIAVILCCSPVCEKQALFALCKSVKENGLEPHLVKKVLEKVSE
TFGYRRLEDFMASHLDYLVLEWLNLQDTEHSLYSFPFILLNYTNVEDFYRSCYKVLIPHL
VIRSRFDEVKSIANQIEEDWKSLLAHCFPKILVNILPYFAYEGPGDSGMAQQRETAAKVY
DTLKDENVLGKQIDHLFLNNLPEIVVELLMTLHEPAASGASQSTDLCDFSGDLDPAPNPP
HFPSHVIKATFAYISNCHKTKLKSILEILSKSPDSYQKILLAICEQAAETNNVYKKHRIL
KIYHLFVTLLLKDIKSALGGAWAFVLRDVIYTLIHYINKRPSRFMDVSLRSFSLCCDLLS
RVCHTAVTSCKDALENHLHVIVGTLIPLVDGHMEVQEQVLDLLKYLVIDNKDNENLYMTI
KLLDPFPDHDVFKDLRITQQKIKYSKGPFSLLEEINHFLSVSVYDALPLTRLEGLKDLRR
QLAQHKDQMVDLMRASQDNPQEGVMVKLIVGLSQLCRAAMSHTGEREVLEAVGSCLGEVG
PVGFSTIAIQHSRDTSSTKAPELFVDKELQWTFITLTYLNNTLVEDCVKVRSAAVTCLKS
ILATKTGHSFWEIYKTTPDPMLIYLQPFRTSKKKFLEVPRLDKENPLEGLDDMSLWIPQS
ENHDVWIKRLTCAFLDSGGTKSEILQLLKPMCEVKTDFCQTVLPYLIHDVLLQDTDESRR
NLLSAHVQGFFTSCFRHSSPASRSTTPANLDSEPEHLFRCCVDKKSQRTMLAVVDYMRRQ
KRPSLGTVFDDAFWLELNYLEVAKVAQSCAAHFTALLYAEIYADKKSMEDQDRRSLTFEE
ASQSTAISSLSEKSKEETGIRLQDLLLEIYRSIGEPDSLYGCGGGKVLQPLTRLRTYEHE
AMWGKALVTYDLETAISSSTRQAGIIQALQNLGLCHILSVYLKGLDRENKEWCAELQELH
YQAAWRNMQWDHGLAVSKGLEGPSYHESLYNALQSLRDREFSTFYESLRYARVKEVEELC
KGDLESVYSLYPTLSRLQAIGELENIGELFSSSGTDRQPSEVYTKWRKHSQLLKDSDFSF
QEPIMALRTVILEILMEKEMENSQRDCFRDILTKHLVEFSVLARTVKNTQLPERAIFQIK
QYNPARCGVSEWQLEEAQVFWAKKEQSLALSILKQMIKKLDASCAENDPDLRLIYAECLR
VCGTWLAETCLENPAVIMQTYLEKAVEVAGNYEGESSDELRNGKMKAFLSLARFSDTQYQ
RIENYMKSSEFENKQALLKRAKEEVGLLREHKIQTNRYTVKVQRELELDECALRALKEDR
KRFLCKAVENYISCLLSGEGHDMWIFRLCSLWLENSGVSEVNGMMKTDGMKIPSYKFLPL
MYQLAARMGTKMMGGLGFHEVLNNLISRISMDHPHHTLFIILALANANKDEFLTKPEAAR
RNRIIKNAPKQSSPLDEDRTEAANRIIHTIRSRRPHMVRSVEALCDAYIILANLDAAQWK
TQRKGINIPADQPITKLKNLEDVVVPTMEIKVDPTGEYRNLVTIASFKAEFRLAGGLNLP
KIIDCLGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLLQRNTETRKRKLTICTYKVVP
LSQRSGVLEWCTGTVPIGEFLVNNENGAHKRYRPKDLSAIHCQKKMMDVQKKSFEEKYKT
FMNVCQKFQPVFRYFCMEKFLDPAVWFEKRLAYTRSVATSSIVGYILGLGDRHVQNILIN
EQSAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEKTMEVMR
SSQETLLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDDTELQSTPAGEDQECKRNLSDTD
QSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKNLSRLFPGWKAWV
NT seq 9174 nt   +upstreamnt  +downstreamnt
atgagtttagcactgaacgatctgcttatttgctgccgtcaactggaacatgacagagcc
accgaacgaaggaaagaagttgagaaatttaagcgcctgattcgggatcctgaaactgtt
caacatttagatcgacattcagattccaaacaaagcaaatacttgaattgggatgctgtg
tttcgatttttacagaaatatgttcagaaagaaacagaatgtctgagaacagcgaaacca
agtgtatcagcctcaacacaagccactagacagaaaaagatgcaagaaatcagtagtttg
gtcaagtacttcatcaaatgtgcaaataaaagagcacccagactgaaatgtcaagaactc
ttgaattatatcatggatacagtgaaagattcatctaatggttccatttatggagcagat
tgtagcaacattctgctcaaggacgttctctcagtgaggaaatactggtgtgaaatatct
cagcaacagtggctagaattgttctctgtgtacttcagtctgtaccttaaacctgcacaa
gacattaatagagttttagtggctagaataattcatgctgtgaccaaaggatgctgttcg
caaactgatggattaaattccaaatttttggatttcttttccaaagctattcaacatgca
agacaggaaaagggttctgcaggtctgaatcacatcttagcagcatttgttatcttcctc
aagacactggctgttaactttcgaattcgagtgtgtcaattaggagatgaaattcttcct
gccttgctttatatttggactcaacatagacttaatgactccttaaaagaagtaattatt
gaattacttcaactgcaaatatatgtgcatcatccaaagggagcgaaaactcaagaaaaa
ggtgcttatgaatcaagtaaatggagaagtatcctatataacttatatgatctgctaatt
aacgagataagtcatataggaagcagagggaagtattcttcaggctctcgtaacgtggct
gtcaaagaaaacttgattgagttgatggcagatatttgccaccagatttttaatgaagat
actagatctctggagatttctcagtcttatactaccacccaaagagaatgtaatgattac
agtgcgccttgcaaaaagaagaaaatacagttaggctgggaagtaataaaagatcatctt
cagaagtcacagagtgattttgatcttgtgccttggttacagattacaacccagttaata
tcaaaatatccttcaagtttacctaactatgagttgtcaccattactgatgatactgtac
cagcttctacctcaacatcgacacggggagcgcacgccatatgtgttacgatgccttacg
gaagttgcattgtgtcaaggcaagaaatcaaacctagaaggctcgcagaaatcagatttg
ttgaaattctggattaaaatttggtctcttacctttcgtggtataagttctgagcagata
caagctgaaaactttggtttacttggagctataattcaaggcagtttaattgaggttgat
agagaattctggaagttatttactgggtcagcctgcagaccatcacgtcctgcagtctgc
tgcctgactctggccatggccatctgtggggttccagaaactgtaaaaacgggagtggag
cagagtatatgtgaagtaaatagaagttgttctttaaaggaactgataatgagacggctc
ttactctctcagttagaggatgacttggaagacaggacagagctgccaccagttcttcac
agtaattttcctcatcttgcagtagagaaaattcttgtgagtctcactgtgaaaaactgt
aaagctgcaatgaattttctccaaagagtgccagaatgtgaacaacaccaaaaagttcaa
gaagagccttcattctcagaagttgaagaactatttcttcaaacaacttttgacaagatg
gattttttaaccattgtgaaagaatgtgctgtagaaaagcaccaggccaccgtaggcttt
tctgtccaccaaaacctcaaggagtcactggatcgctatctcctgggattatcagaacag
cttttaaataactactcgcctgagactacaaatgcagaaacgcttatccggtgttcgagt
cttctggtgggtgttcttggatgctactgttacgtgggagtagtagctgaagaggaagca
tatagatcagaactgttccagaaagccaagtctctaatgcagtgtgcaggagaaagtatc
actctgttcaaaaataagacctacgaggaatctagggttgcttccctgaggaatgtgatg
actctctgtaccggttgcttatgcaactgtaccaagcccagtccaaataaaattgcatct
agatttttcctacgattgttgacatcaaagctcatgaatgatattgcagatatctgtaga
agtttggcgtcctttatcagaaagcccctggacttgggagaagtagaatccatggaggac
gatcctgatgagaatctgatggaggtggaggaccagtcgtccatgcatctgttcagtgac
gcccctgcctgcggcactagtgacgcggctgtgtctggagatagcgggagcaccttcggt
gccatgaatcctttagctgaagaacatctgtcaaagcaagatctactctttttagacatg
ctcaagttcttgtgtgtgtgtacaactactgctcagactggaactgtgtcatttagagcg
gccgacattcggaggaaattgttgatgttagtggatactagcatgctagaccctgctaaa
tctctccacctacgcatgtatctagtgcttttaaaggagcttcctggagaagaatatcct
ttgccaatagaagaggtttttgaacttctaaaaccactctccaacgtgtgttctttatat
cgccgtgaccaggatgtttgtagaacagttttaaaccacttagttcctgtagtaaggaac
ctgtgtcaaggcgatatggacgctgaaaacacaagggatgctcaagggcagttgctaaca
gtgattggagcattctggcacctagcaaaggaggggaaatgcacattctctgtacgaatg
gcactagtaaagtgccttaaaactttgcttgagactgatccttactcaaaatgggctgtt
cttaatgtaatgggaaaagactttcctgtaaacgaagtatttccacattttctcggtgat
cgtcatcatcaagttagcatgttggctgccgagtccgtcaacaggttattccaggatatg
aaacacagaggctcgtccacattattgaaagcacttcctttgaagcttcagcaaacagct
tttgaaaatgcatacttgaaagctctggaaggaatgagagaagtgtcccacagagctgag
aaccctgaacttttggatgagatctataacagaaaatctgttttactgatgacgatagct
gtgattttatgctgtagcccagtctgtgaaaaacaggctttgtttgcactatgcaagtct
gtgaaagaaaacggattagaacctcacctcgttaaaaaggttttagagaaagtttctgaa
acatttggatacagacgtttggaagacttcatggcttctcatttggattatctggttttg
gaatggctaaatcttcaagatactgaacatagtttatattcttttccttttattttacta
aattacacaaatgttgaggatttctatagatcatgttacaaggttttgatcccacatctg
gtgattagaagtcgttttgatgaggttaagtccattgctaatcagattgaagaggattgg
aaaagtcttctagcacattgctttccaaagattcttgtaaatattcttccttactttgcc
tacgagggtccaggagacagtgggatggcacagcagagagagactgctgccaaagtctat
gatacccttaaagatgaaaacgtcctaggaaaacagattgatcatttattccttaataat
ttaccagagattgtggtggagttactgatgacgttacatgaaccggcagcttctggtgcc
agccagagcacggacctctgtgacttttcaggggatttggatcctgcccctaatccacct
cattttccatcacatgtgattaaagcaacatttgcctatatcagcaattgccataaaacc
aagctgaaaagcattttagaaattctttccaaaagccctgattcctatcagaaaattctt
ctagccatttgtgagcaagctgctgagacaaataatgtttataaaaagcacagaattctt
aaaatatatcacctgtttgttactttattactgaaagatattaaaagtgccttaggagga
gcttgggcctttgttcttcgagatgttatctatactttgattcattatatcaacaaaagg
ccttctcgtttcatggatgtgtcgttacggagcttttccctgtgctgtgacctgctaagc
cgggtttgccacacggcagtcacttcctgtaaggatgctctagaaaatcatcttcacgtg
attgttggtacgctcatcccccttgtggatggtcacatggaggtgcaggaacaggtattg
gacttgttgaaatacttagtgatagataacaaggataatgaaaacctctatatgacaatt
aaacttctagatcctttccctgaccatgatgtctttaaggatttgcgcattactcagcag
aaaattaaatacagtaaaggacccttttcacttttggaggaaataaatcattttctctcc
gtgagtgtttacgatgcacttcctttgacaaggctggaaggactcaaggatctccgcaga
cagctagctcagcacaaggaccagatggtggacctcatgagagcatctcaggataacccg
caggagggcgtcatggtgaagctcatcgtcggcttgtcgcagttatgccgcgcggccatg
agccacactggggagcgggaggttttagaggctgttgggagctgcctgggagaagtgggt
cctgtcggtttctccacgatagctatacagcatagtagagatacatcttctaccaaggcc
cccgagttatttgtagataaagaacttcagtggacctttataacactgacctacctgaac
aacacgctcgtagaagattgtgtcaaagtgcgatcagctgctgttacctgtttgaaaagc
attttagctacaaagactggacatagtttctgggagatttacaagacgacacctgatccc
atgttgatctatctacagccttttagaacatccaaaaaaaagtttttggaagtgcccaga
ctagacaaagaaaatcctttagaaggcctggatgatatgagcctgtggattcctcaaagt
gaaaaccatgatgtttggataaagaggctgacttgtgcttttttggatagtggaggcaca
aaaagtgaaattcttcaattattaaagccaatgtgtgaagtgaaaacggacttttgtcag
actgtgcttccatacttgattcatgatgttctactccaagatacagatgaatcacggaga
aacctgctttctgcacacgttcagggatttttcacgagctgtttcagacactcctcacca
gcgagccgatccacgacccccgcaaatttggattcagagcccgagcacctgttccgatgc
tgtgtggataaaaagtcacagaggacaatgcttgccgttgtggactacatgaggagacag
aagagaccctccttaggaacagtttttgatgatgccttctggctggagttgaattatcta
gaggttgccaaggtcgctcagtcttgtgctgctcactttacagcattgctctacgcagaa
atctacgcagataagaaaagcatggaagaccaagacagaagaagtcttacgtttgaagaa
gcaagccagagtacagctatctctagtttgagtgaaaaaagtaaagaagaaactggaata
cgtttacaggatctgctcttagaaatctacagaagtataggagagcccgatagcctgtac
ggctgtggcggagggaaggtcttgcagcccctcactagactacgcacatacgagcatgaa
gcaatgtgggggaaggccctggtgacctatgaccttgagacggccatctcctcctcaacc
cgccaggcggggataattcaggccttgcagaatttgggactctgccatattctttccgtc
tatttgaaaggactagatcgtgagaataaggagtggtgcgcggagctccaggaactccac
taccaggcagcgtggaggaacatgcagtgggaccacggcctcgccgtcagcaaaggacta
gaaggacccagttaccacgaatcactgtacaatgctctgcagtctctgagagatagagaa
ttctccacattttatgaaagtctcagatatgccagggtgaaagaagtggaagagctgtgc
aagggggaccttgaatctgtgtactccctctaccccactctcagcaggctgcaggctatc
ggcgagctcgagaacatcggggagctgttctccagctcaggcacggataggcaaccttcc
gaagtgtacactaagtggcggaaacactcccagctcctcaaggacagtgacttcagtttt
caggagcccatcatggctctccgcacggtcattttggagatcctcatggaaaaggaaatg
gagaattcccagagagactgtttcagggatattctcaccaagcaccttgtagaattctct
gtactagcccgaactgtcaagaacacacagctccctgaaagggcaatatttcaaattaaa
caatataatccagctcgttgtggagtctctgagtggcagctggaggaagcccaagtattt
tgggcaaagaaggagcagagtctcgccctgagtattctcaagcagatgatcaagaagctg
gatgccagctgtgcagagaatgatcccgacctaagacttatatatgcagaatgtctgagg
gtgtgcggcacctggttagcggaaacttgcctggagaaccctgcggtcatcatgcagacc
tacctagagaaggcagtggaagttgctggaaattacgagggagaaagcagtgatgagctt
agaaatggaaagatgaaagcatttctctcattggcacggttctcggacactcagtaccag
agaattgaaaactacatgaaatcatcagagtttgaaaacaagcaggctcttctgaaaagg
gccaaagaggaagtgggccttcttagggaacataaaatccagaccaacagatacacagta
aaggtccagcgggagctggagctggatgagtgcgcgctccgtgccctgaaagaggaccgt
aagcgcttcttatgtaaagcagttgaaaattacatcagttgcttactgagtggagaagga
catgatatgtggatattccgtctttgttctctctggcttgaaaattccggagtttctgaa
gtcaatggcatgatgaagaccgatggaatgaagattccatcatacaaatttttgcctctt
atgtaccagttggctgctagaatggggaccaaaatgatgggaggccttggatttcacgaa
gtcctcaataatcttatctctcggatttcaatggatcacccccatcacactttgtttatc
atactggccttagcaaatgcaaacaaggatgaatttttgaccaaaccagaggcagcaaga
aggaaccgaataattaaaaatgcacctaaacaaagctctccactcgacgaggatcgaacc
gaggctgcaaacagaataatacacactatccgaagtaggagacctcacatggtcagaagt
gttgaggcgctctgtgatgcgtacatcatattagcaaacttagatgccgctcagtggaag
actcagagaaaaggcataaatatcccagcagaccagccaattactaaactgaagaattta
gaagacgttgttgttccaactatggaaattaaggtggaccccaccggagaatacagaaat
ctggtgactatagcgtcatttaaagcagaatttcgtttagcaggaggtttaaatttacct
aaaataatagactgtctgggctccgatggcaaggaaaggagacagctcgtcaagggccgt
gacgacctgagacaggatgcagtcatgcagcaggttttccagatgtgtaacacgttactg
cagaggaacacggagacccggaagaggaaactgaccatctgcacatacaaggtggttccg
ctctcccagcgaagcggtgtgctcgagtggtgcacggggaccgtccccatcggcgagttc
cttgtcaacaacgagaacggtgctcataagcgatacaggccgaaggacttgagcgccatt
cactgccagaagaagatgatggatgtacaaaagaagtcttttgaagagaaatataaaaca
ttcatgaatgtctgccaaaaatttcagcctgttttccgttacttctgcatggaaaaattc
ctcgacccagcagtttggttcgagaagcgactggcttacactcgcagcgtggccacttcc
tctatcgttggttacatactcggacttggtgatcgacacgtacagaatatcttgatcaat
gagcaatctgcagaacttgtacatatagatttgggagttgcttttgagcaggggaagatc
ctcccgactcctgaaacggttcctttcagactcaccagagatattgtggacgggatgggc
attactggtgttgaaggagtctttagaagatgctgcgagaaaaccatggaggtcatgaga
agctctcaggaaaccctgctgaccatagtggaggttctcctctacgaccccctgtttgac
tggaccatgaacccgctgaaggctctgtatttgcagcagaggccggaggacgacactgag
ctgcagtccactcccgccggagaggaccaggaatgcaaacgcaatctcagtgacactgac
cagagtttcaacaaagtagcggaacgcgtcctgatgagactgcaagagaaactgaaagga
gtggaggaaggaacggtgctcagtgtcgggggccaagtgaacctgctcatacagcaagcc
atggaccccaaaaatctcagccggctcttcccaggatggaaagcttgggtgtga

DBGET integrated database retrieval system