KEGG   Enhydra lutris kenyoni (northern sea otter): 111153780
Entry
111153780         CDS       T05871                                 

Definition
(RefSeq) serine/threonine-protein kinase Chk1
  KO
K02216  serine/threonine-protein kinase CHEK1 [EC:2.7.11.1]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04110  Cell cycle
elk04115  p53 signaling pathway
elk04218  Cellular senescence
elk05166  Human T-cell leukemia virus 1 infection
elk05170  Human immunodeficiency virus 1 infection
elk05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111153780
   04115 p53 signaling pathway
    111153780
   04218 Cellular senescence
    111153780
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111153780
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111153780
   05170 Human immunodeficiency virus 1 infection
    111153780
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111153780
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:elk03400]
    111153780
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111153780
Protein kinases [BR:elk01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   111153780
DNA repair and recombination proteins [BR:elk03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    111153780
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal Kdo APH
Other DBs
NCBI-GeneID: 111153780
NCBI-ProteinID: XP_022368726
UniProt: A0A2Y9K5V4
LinkDB
Position
Unknown
AA seq 476 aa
MAVPFVEDWDLVQTLGEGAYGEVQLAVNRRTEEAVAVKIVDMKRAVDCPENIKKEICINK
MLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEQDAQRFFHQLMAGVVY
LHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRHNNRERLLNKMCGTLPYVAPELLK
RKEFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLA
LLHKILVENPSVRITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPTRFSKHIQSNLDF
SPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCPDHMLLNSQLL
GTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKSCMNQVTVSTTDRR
NNKLIFKVNLVEMDEKILVDFRLSKGDGLEFKRHFLKIKGKLSDVVSSQKVWLPVT
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggcagtgccctttgtggaagactgggacttggtgcaaaccctgggagaaggtgcctat
ggagaggttcaacttgctgtgaatagaagaactgaagaagcagttgcagtcaagattgta
gacatgaagcgtgccgtagactgtccagaaaatattaagaaagagatctgtatcaataaa
atgctaaatcatgagaatgtggtgaaattttatggtcacaggagagaaggcaatatccag
tatctatttctggagtactgtagtggaggagaactttttgacagaatagagccagacata
ggcatgcctgaacaagatgctcagaggttcttccatcaactcatggcgggggtggtttat
ctgcatggtattgggataactcacagggatattaagccagaaaatctcctattggatgaa
agggataacctcaaaatctctgactttggcttggcaacggtgtttcggcataataatcgt
gaacgtttattgaacaagatgtgcggtactttaccatatgttgctccagaacttctaaag
agaaaagaatttcacgcagaaccagttgatgtttggtcctgtggaatagtacttacggca
atgttggctggagaattgccatgggaccagcccagtgacagttgtcaggaatactctgat
tggaaagaaaaaaaaacatacctcaacccttggaaaaaaattgattcagctcctctagct
ttgctgcataaaatcctagttgagaatccatcagtaaggattaccatcccagacatcaaa
aaagatagatggtacaataaaccactcaagaaaggggcaaagaggccccgagtcacttca
ggtggtgtatcagaatctcctactagattttctaagcacattcaatccaatttggacttc
tctccagtgaatagtgcctctagtgaagaaaatgtgaagtattccagttcccagccagaa
ccacggacaggtctttcattatgggacaccagtccttcatatattgataaactggtacaa
gggatcagtttttcccaacccacgtgtcctgatcacatgctcctgaatagtcaattactt
ggcactccaggatcttcacagaacccttggcagcgcttggttaaaaggatgacacgattt
tttaccaaattggatgcagacaaatcttatcaatgcctgaaagagacttgtgagaaattg
ggctatcagtggaaaaagagttgtatgaatcaggttactgtatcaacaactgataggaga
aacaataaactgattttcaaagtgaatttggtagaaatggatgagaagatcttggttgac
tttcggctttctaagggtgatggattagaattcaagagacacttcctgaagattaaagga
aagctgagtgatgttgtgagcagccagaaggtttggcttcctgtcacatga

DBGET integrated database retrieval system