KEGG   Enhydra lutris kenyoni (northern sea otter): 111154044
Entry
111154044         CDS       T05871                                 

Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk00230  Purine metabolism
elk01100  Metabolic pathways
elk01522  Endocrine resistance
elk04015  Rap1 signaling pathway
elk04020  Calcium signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04024  cAMP signaling pathway
elk04062  Chemokine signaling pathway
elk04072  Phospholipase D signaling pathway
elk04114  Oocyte meiosis
elk04211  Longevity regulating pathway
elk04213  Longevity regulating pathway - multiple species
elk04261  Adrenergic signaling in cardiomyocytes
elk04270  Vascular smooth muscle contraction
elk04371  Apelin signaling pathway
elk04540  Gap junction
elk04611  Platelet activation
elk04713  Circadian entrainment
elk04714  Thermogenesis
elk04723  Retrograde endocannabinoid signaling
elk04724  Glutamatergic synapse
elk04725  Cholinergic synapse
elk04727  GABAergic synapse
elk04740  Olfactory transduction
elk04750  Inflammatory mediator regulation of TRP channels
elk04911  Insulin secretion
elk04912  GnRH signaling pathway
elk04913  Ovarian steroidogenesis
elk04914  Progesterone-mediated oocyte maturation
elk04915  Estrogen signaling pathway
elk04916  Melanogenesis
elk04918  Thyroid hormone synthesis
elk04921  Oxytocin signaling pathway
elk04923  Regulation of lipolysis in adipocytes
elk04925  Aldosterone synthesis and secretion
elk04926  Relaxin signaling pathway
elk04927  Cortisol synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk04962  Vasopressin-regulated water reabsorption
elk04970  Salivary secretion
elk04971  Gastric acid secretion
elk04972  Pancreatic secretion
elk04976  Bile secretion
elk05032  Morphine addiction
elk05163  Human cytomegalovirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05200  Pathways in cancer
elk05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:elk00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111154044
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    111154044
   04371 Apelin signaling pathway
    111154044
   04020 Calcium signaling pathway
    111154044
   04072 Phospholipase D signaling pathway
    111154044
   04024 cAMP signaling pathway
    111154044
   04022 cGMP-PKG signaling pathway
    111154044
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111154044
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111154044
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111154044
   04062 Chemokine signaling pathway
    111154044
  09152 Endocrine system
   04911 Insulin secretion
    111154044
   04923 Regulation of lipolysis in adipocytes
    111154044
   04912 GnRH signaling pathway
    111154044
   04913 Ovarian steroidogenesis
    111154044
   04915 Estrogen signaling pathway
    111154044
   04914 Progesterone-mediated oocyte maturation
    111154044
   04921 Oxytocin signaling pathway
    111154044
   04926 Relaxin signaling pathway
    111154044
   04935 Growth hormone synthesis, secretion and action
    111154044
   04918 Thyroid hormone synthesis
    111154044
   04928 Parathyroid hormone synthesis, secretion and action
    111154044
   04916 Melanogenesis
    111154044
   04925 Aldosterone synthesis and secretion
    111154044
   04927 Cortisol synthesis and secretion
    111154044
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111154044
   04270 Vascular smooth muscle contraction
    111154044
  09154 Digestive system
   04970 Salivary secretion
    111154044
   04971 Gastric acid secretion
    111154044
   04972 Pancreatic secretion
    111154044
   04976 Bile secretion
    111154044
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    111154044
  09156 Nervous system
   04724 Glutamatergic synapse
    111154044
   04727 GABAergic synapse
    111154044
   04725 Cholinergic synapse
    111154044
   04723 Retrograde endocannabinoid signaling
    111154044
  09157 Sensory system
   04740 Olfactory transduction
    111154044
   04750 Inflammatory mediator regulation of TRP channels
    111154044
  09149 Aging
   04211 Longevity regulating pathway
    111154044
   04213 Longevity regulating pathway - multiple species
    111154044
  09159 Environmental adaptation
   04713 Circadian entrainment
    111154044
   04714 Thermogenesis
    111154044
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111154044
  09165 Substance dependence
   05032 Morphine addiction
    111154044
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    111154044
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111154044
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111154044
   05163 Human cytomegalovirus infection
    111154044
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111154044
Enzymes [BR:elk01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     111154044
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA Peptidase_S49_N
Other DBs
NCBI-GeneID: 111154044
NCBI-ProteinID: XP_022369106
UniProt: A0A2Y9K6S8
LinkDB
Position
Unknown
AA seq 1213 aa
MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLAPLLVAAMGLLLDLL
LFVLCKKGLLPDRVTRKVVPYVLWLLITAQIFSYLGLNFSRAHAASDTVGWQTFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQDGLKGTHLLREILANVFLYLCAIVVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTLDCLKGEFDVEPGEGGSRCE
YLDEKGIETYLIIASKPEVKKTAAQHGLGGPALLNGAPASSKPGSPALIETKEPSGSVHT
SGSTSEEPEDQDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMDPDMETRYSVEKEKQSGAAFSCSCVVLLCTALVEILIDPWLMTN
YMTFVVGEVLLLILTVCSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYYTGPNNSTTGLDVEDGCVENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
LLVAGAVAVINIYAWRPIFDEYDRKRFQEHDFPVVALEKMQGLSTPGLNSTGRLPLVPSK
YSMTVMVFVMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEH
VARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDF
DSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFAGSNKEEKSDKERWQHLADLADF
ALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGV
MGNIQVWPAAEQSMCSEAGAGNKIGLGRVAMRSCLSIGPGYQGGSSGRSRARVGNTSLPF
PRLGLKLLVTLSFWYELSNLSYHRQLPPEAAPNHASCVWQESTTKQGEGTQEQGVMLPET
TQGCPSGQRALLL
NT seq 3642 nt   +upstreamnt  +downstreamnt
atgccgaggaaccagggcttctccgaacctgagtactcggccgagtactccgcggagtac
tcggtcagcctgccctctgaccctgaccgcggagtgggccggacccacgaaatctcggtc
cggaactcgggatcctgcctctgcctgcctcggttcatgcgactgaccttcgtgcccgag
tccttggagaacttgtatcagacctacttcaaacggcagcgtcacgagaccctgctggtg
ctggtggtgttcgcggccctctttgactgctacgtggtggtgatgtgcgccgtggtcttc
tccagcgacaagctggctcctctcctcgtggcggccatgggactgctgttggacctcctc
ctcttcgtgctctgcaaaaaggggctgctccccgaccgggtcacccggaaagtggtgccc
tacgtgctgtggctgctgatcaccgcccagattttctcctacctgggcctgaacttttcg
cgagcccatgcagccagcgacacggtgggctggcagaccttcttcgtattctccttcttc
atcacgctgccgctcagcctcagccccattgtcatcatctccgtggtctcctgtgttgtg
cacacactcgtcttgggggtcaccgtggcccagcagcagcaggacgggctgaagggcacg
cacttgctgagggagatcctggccaatgtcttcctctacctgtgcgccatcgtcgtgggc
atcatgtcctactacatggcggaccgcaagcaccgcaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaacctggaggagcagagccagcagcaggagaaccttatgctt
tccatcctgcccaagcacgtggctgatgagatgctgaaggacatgaagaaggacgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccggcacgagaacgtcagcatc
ctctttgcggacatcgtgggcttcacccagctgtcctcggcctgcagcgcccaggagctc
gtgaagctgctcaatgagctgtttgcccgcttcgacaagctggctgccaaataccaccag
ctgcggattaagatcctgggcgactgctactactgcatctgcggcctgcccgactaccgg
gaggaccacgccgtctgctccatcctcatggggctcgccatggtggaggccatctcgtac
gtgcgggagaagacgaagacaggggtggacatgcgtgtgggggtgcacacgggcaccgtg
ctggggggcgtcctgggccagaaacgctggcagtacgacgtgtggtcgaccgacgtcact
gtggccaacaagatggaggctggtggcatccccgggcgtgtgcacatctcccagagcacc
ctggactgcctgaagggcgagttcgacgtggagccaggcgaggggggcagccgttgtgag
tacctagacgagaagggcatcgagacctacctcatcatcgcgtccaagccggaggtgaag
aagacagccgcccagcatggcctcggcggtccggccctgctgaacggcgccccggcctcc
tccaagcccggctcccccgccctcattgagaccaaggagcctagcgggagtgtccacacc
agcggctccacgtcggaggagcccgaggaccaggatgcccaggccgacaatccctcgttc
cccaacccgcgccggaggctgcgccttcaggacctggcggaccgagtggtggacgcctct
gaggacgagcacgagctcaaccagctgctaaacgaggcgctgctggagcgagagtccgcc
caggtagtgaagaagagaaacacctttctcctttccatgcggttcatggaccccgatatg
gaaacccgctactcggtggagaaggaaaagcagagtggggctgccttcagctgctcctgt
gttgtcctgctctgtacggccctggtcgagatactcatcgacccctggctaatgaccaac
tacatgacctttgtggttggggaggttctgctgctgatcctgacggtctgctcgctggct
gccatctttccccgggcctttcctaagaagctcgttgccttctcgacctggatcgaccgg
acccgctgggccaggaacacctgggccatgttagccatcttcattctggtcatggcaaac
gtcgtggacatgctcagctgtctccagtactacaccgggcccaataacagcaccacaggg
ctggacgtagaggacggctgcgtggagaaccccaagtattacaactatgttgccgttctg
tccctcatcgccaccatcatgctggtgcaggtcagccacatggtgaagctcacactcatg
ctgctcgtcgcgggggccgtggccgtcatcaacatctacgcctggcgccccatctttgat
gagtacgaccgcaagcgctttcaggaacacgactttcccgtggtcgccttagagaagatg
cagggactttccacccctgggctcaacagcactggcaggctgcccctggtgccctctaag
tactccatgaccgtgatggtcttcgtcatgatgctgagcttctactacttctcgcgccat
gtggaaaaactggcaaggacactgttcttgtggaagattgaagtccatgaccagaaagaa
cgtgtctacgagatgcggcgctggaatgaggccttggtcaccaacatgctgcctgagcac
gtggcccgccatttcctggggtccaagaagagagacgaggagctgtacagccagtcctac
gacgagatcggagtcatgttcgcctccctgcccaacttcgccgacttctacacggaggag
agcatcaacaacggcggcatcgagtgtctgcgcttcctcaacgagatcatctcagacttt
gattctctgctggacaaccccaaattccgggtcatcaccaagatcaaaaccatcggtagc
acctacatggcagcttcaggagtcaccccagatgtcaacaccaacggctttgccggctcc
aacaaggaggagaagtccgacaaggagcgctggcagcacctggctgatctggcggacttt
gctctggccatgaaggacacgctcacaaacatcaacaaccagtccttcaacaacttcatg
ctgcgcatcggcatgaacaaaggaggggtcctggctggggtcattggagcccggaaacca
cactatgacatctggggcaatacggtcaatgtggccagcaggatggagtccacgggggtc
atgggcaacattcaggtatggccagcagcagagcagagcatgtgctcagaagcaggggcc
gggaacaagatcggactagggcgtgttgccatgcgctcctgcctgtccattggcccaggg
tatcaagggggtagctctggaaggtcgcgggcaagggtgggaaatacttcactccccttt
ccaagacttgggcttaagcttttggtaaccctatccttttggtatgaactttctaatctc
tcgtaccaccgccaacttccccctgaagccgccccgaatcatgccagctgcgtctggcag
gagagcaccacaaagcagggagaggggacacaagaacagggagtgatgctgccagagaca
acccagggctgtccttcgggtcagcgagcgctattgctgtga

DBGET integrated database retrieval system