KEGG   Enhydra lutris kenyoni (northern sea otter): 111154190
Entry
111154190         CDS       T05871                                 

Definition
(RefSeq) 3-oxo-5-alpha-steroid 4-dehydrogenase 2
  KO
K12344  3-oxo-5-alpha-steroid 4-dehydrogenase 2 [EC:1.3.1.22]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk00140  Steroid hormone biosynthesis
elk05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    111154190
 09160 Human Diseases
  09162 Cancer: specific types
   05215 Prostate cancer
    111154190
Enzymes [BR:elk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     111154190
SSDB
Motif
Pfam: Steroid_dh DUF1295
Other DBs
NCBI-GeneID: 111154190
NCBI-ProteinID: XP_022369349
UniProt: A0A2Y9KCS3
LinkDB
Position
Unknown
AA seq 254 aa
MPLPCQQSPVLAGSATLAALGALVLYLAKPSGYGKYSESLLPTATRLPSRAAWFLQELPS
FAVPAGFLARQPRSLFGQPATVLLGLFCAHYFHRTFVYSLLTRGRPFPVAFLVRGFVFCT
GNGLLQGYYLIYCAEYPSEWYTDGRFRLGVFLFILGMGVNIHSDYILRQLRKPGEVIYRI
PQGGLFTYVSGANFLGEITEWIGYALASWSLPALGFAFFSLCFLGLRAFHHHRFYLKMFE
DYPKSRKALIPFIF
NT seq 765 nt   +upstreamnt  +downstreamnt
atgccccttccctgccagcagagcccggtgctggcaggcagcgccactctggccgccctg
ggggcactggtcctgtacctggcgaagccctccggctacgggaagtactcggagagccta
ctgcccaccgctacccgcctgccctcccgcgccgcctggttcctgcaggagctgccctcc
ttcgcggtgcccgcggggttcctcgcccggcagccgcgctcgctcttcggccagcctgcg
accgtgctcctgggcctcttctgcgcacattacttccacaggacatttgtttactcatta
ctcactagagggaggcctttcccagttgcgttccttgtcagagggtttgtcttctgcacg
ggaaatggacttctccagggctactacctgatttactgtgctgaatacccctctgagtgg
tacacagacggacggtttcgcctgggtgtcttcttatttattttgggaatgggagtcaac
attcatagtgactatatattgcgccagctcaggaagcccggagaagtcatctataggatt
ccacaaggtggcttgtttacgtatgtttctggagccaatttcctcggtgagatcactgaa
tggatcggctatgccctggccagttggtccctcccagcacttggatttgcgtttttctca
ctttgtttcctggggctgcgagcttttcaccatcacaggttctacctcaagatgtttgag
gactatcccaaatctcggaaggccctcattccatttatcttctaa

DBGET integrated database retrieval system