KEGG   Enhydra lutris kenyoni (northern sea otter): 111154217
Entry
111154217         CDS       T05871                                 

Definition
(RefSeq) apoptosis regulator Bcl-2
  KO
K02161  apoptosis regulator Bcl-2
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk01522  Endocrine resistance
elk01524  Platinum drug resistance
elk04064  NF-kappa B signaling pathway
elk04066  HIF-1 signaling pathway
elk04071  Sphingolipid signaling pathway
elk04115  p53 signaling pathway
elk04140  Autophagy - animal
elk04141  Protein processing in endoplasmic reticulum
elk04151  PI3K-Akt signaling pathway
elk04210  Apoptosis
elk04215  Apoptosis - multiple species
elk04217  Necroptosis
elk04261  Adrenergic signaling in cardiomyocytes
elk04340  Hedgehog signaling pathway
elk04510  Focal adhesion
elk04621  NOD-like receptor signaling pathway
elk04630  JAK-STAT signaling pathway
elk04722  Neurotrophin signaling pathway
elk04725  Cholinergic synapse
elk04915  Estrogen signaling pathway
elk04928  Parathyroid hormone synthesis, secretion and action
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk05014  Amyotrophic lateral sclerosis
elk05022  Pathways of neurodegeneration - multiple diseases
elk05132  Salmonella infection
elk05145  Toxoplasmosis
elk05152  Tuberculosis
elk05161  Hepatitis B
elk05162  Measles
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05200  Pathways in cancer
elk05206  MicroRNAs in cancer
elk05210  Colorectal cancer
elk05215  Prostate cancer
elk05222  Small cell lung cancer
elk05226  Gastric cancer
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111154217
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    111154217
   04630 JAK-STAT signaling pathway
    111154217
   04064 NF-kappa B signaling pathway
    111154217
   04066 HIF-1 signaling pathway
    111154217
   04071 Sphingolipid signaling pathway
    111154217
   04151 PI3K-Akt signaling pathway
    111154217
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111154217
  09143 Cell growth and death
   04210 Apoptosis
    111154217
   04215 Apoptosis - multiple species
    111154217
   04217 Necroptosis
    111154217
   04115 p53 signaling pathway
    111154217
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111154217
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111154217
  09152 Endocrine system
   04915 Estrogen signaling pathway
    111154217
   04928 Parathyroid hormone synthesis, secretion and action
    111154217
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111154217
  09156 Nervous system
   04725 Cholinergic synapse
    111154217
   04722 Neurotrophin signaling pathway
    111154217
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111154217
   05206 MicroRNAs in cancer
    111154217
  09162 Cancer: specific types
   05210 Colorectal cancer
    111154217
   05226 Gastric cancer
    111154217
   05215 Prostate cancer
    111154217
   05222 Small cell lung cancer
    111154217
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    111154217
   05022 Pathways of neurodegeneration - multiple diseases
    111154217
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111154217
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111154217
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111154217
   05152 Tuberculosis
    111154217
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111154217
   05161 Hepatitis B
    111154217
   05162 Measles
    111154217
   05168 Herpes simplex virus 1 infection
    111154217
   05169 Epstein-Barr virus infection
    111154217
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111154217
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111154217
   01524 Platinum drug resistance
    111154217
   01522 Endocrine resistance
    111154217
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:elk01009]
    111154217
Protein phosphatases and associated proteins [BR:elk01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111154217
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 111154217
NCBI-ProteinID: XP_022369400
UniProt: A0A2Y9KJC0
LinkDB
Position
Unknown
AA seq 234 aa
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDSGAAPPGAAPAPGIFSSQPGRTPAPA
RTSPPPPPAALAAAAAAGPTLSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFT
ARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHL
HTWIQDNGGWDAFVELYGPSVQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
NT seq 705 nt   +upstreamnt  +downstreamnt
atggcgcacgctgggagaacagggtatgataaccgggagatagtgatgaagtacatccac
tataagctgtcgcagaggggctacgagtgggatgccggagactcgggcgccgcgcccccg
ggggccgcccccgcgccgggcatcttctcctcccagcccgggcgcacccccgcgcccgcc
aggacctcgccgcccccgccccccgccgccctcgccgccgctgccgccgcgggccctacg
ctcagccccgtgccacctgtggtccacctgaccctgcgccaggccggcgacgacttctcc
cgtcgctaccgccgcgacttcgcagagatgtccagccagctgcacctgacacccttcacc
gcgaggggacgctttgccacggtggtggaggagctcttcagggatggggtgaactggggg
aggattgtggccttctttgagttcggtggggtcatgtgtgtggagagcgtcaaccgggag
atgtcgcccctggtggacaacatcgccctatggatgactgagtacctgaaccggcacttg
cacacctggatccaggacaacggaggctgggatgcctttgtggagctgtacggccccagc
gtgcagcctctgtttgacttctcctggctgtccctgaaggccctgctcagtctggccctg
gtgggagcttgcatcaccctgggtgcctacctgggccacaagtga

DBGET integrated database retrieval system