KEGG   Enhydra lutris kenyoni (northern sea otter): 111154272
Entry
111154272         CDS       T05871                                 

Definition
(RefSeq) phorbol-12-myristate-13-acetate-induced protein 1
  KO
K10131  phorbol-12-myristate-13-acetate-induced protein 1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01524  Platinum drug resistance
elk04115  p53 signaling pathway
elk04210  Apoptosis
elk04215  Apoptosis - multiple species
elk05200  Pathways in cancer
elk05203  Viral carcinogenesis
elk05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111154272
   04215 Apoptosis - multiple species
    111154272
   04115 p53 signaling pathway
    111154272
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111154272
   05203 Viral carcinogenesis
    111154272
  09162 Cancer: specific types
   05210 Colorectal cancer
    111154272
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111154272
SSDB
Motif
Pfam: PMAIP1
Other DBs
NCBI-GeneID: 111154272
NCBI-ProteinID: XP_022369488
UniProt: A0A2Y9K8Q6
LinkDB
Position
Unknown
AA seq 54 aa
MPGKKARKSAQPSPARAPADPEMECAIQLRKFGDKLNFRQKFLNLLSKLFRSGT
NT seq 165 nt   +upstreamnt  +downstreamnt
atgcctgggaagaaggcgcgtaagagcgcgcagccgagcccagcgcgggccccggcagac
cccgaaatggagtgtgccattcaactcaggaaatttggagacaaactgaatttccggcag
aaatttctgaatctgctctccaaactcttccggtcgggaacctga

DBGET integrated database retrieval system