KEGG   Enhydra lutris kenyoni (northern sea otter): 111154289
Entry
111154289         CDS       T05871                                 

Definition
(RefSeq) serpin B5
  KO
K10139  serpin B5
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04115  p53 signaling pathway
elk05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    111154289
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    111154289
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:elk01002]
    111154289
Peptidases and inhibitors [BR:elk01002]
 Peptidase inhibitors
  Family I4: serpin family
   111154289
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 111154289
NCBI-ProteinID: XP_022369502
UniProt: A0A2Y9K721
LinkDB
Position
Unknown
AA seq 375 aa
MDALRLANSAFAVDLFKQLCEKEPVGNVLFSPICLSTSLSLAQVGAKGDTADEIGQVLHF
ENIKDVPFGFQTVTSDVNKLSSFYSLKLIKRLYVDKSLNPSTEFISSTKRPYAKEMETVD
FKEKLEETKGQINESIKDLTDGRFENTLADNSVSDQTKMLVVNAAYFVGKWMKKFPESET
KECPFRINKTDTKPVPMMSMEATFCMGNVDGINCKVIELPFQNKHLSMLILLPKDVEDES
TGLEKVEQQLNSETLLQWTNPSTMANAKVKLSIPKFKVEKLVDPKASLENLGLKNIFNEN
TSDFSGMSETKGVALSNVIHRVCLEITEDGGDSIEVPGSRILQHKDEFNADHPFIYIIRH
NKTRNIIFFGKFCSP
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggatgctctccgactggcaaattcagcctttgcggttgacctgttcaaacaactgtgt
gaaaaggagccagtaggcaatgtcctcttttctccaatctgtctctccacctctctgtcc
cttgctcaagtaggcgccaaaggggacacggcagatgaaattggacaggtccttcatttt
gaaaatatcaaagatgtaccctttggatttcaaacagtaacatcggatgtgaacaaactt
agttccttttactctctgaaactaatcaaacggctctacgtagacaaatctctgaacccc
tctacagagttcatcagctctacgaagagaccctatgcaaaggagatggaaactgttgac
ttcaaagaaaaattggaagaaacaaaaggtcagatcaacgagtcaatcaaggatctcaca
gatggccgctttgagaacaccttggctgacaacagtgtcagtgaccagaccaaaatgctt
gtggttaatgctgcctacttcgttgggaagtggatgaagaaatttcctgaatctgaaacc
aaagaatgcccgttcagaatcaacaagacagacaccaaacctgtgccaatgatgagcatg
gaggccacattctgtatgggcaacgttgatggtatcaactgtaaggtcatagagcttccc
tttcaaaacaaacacctcagcatgctcattctgctccccaaggacgtggaggatgagtcc
acaggcctggagaaggttgaacaacagctcaactcagagacgctcttgcagtggaccaat
cccagcaccatggccaacgccaaagtcaaactctccattccaaaatttaaggtggaaaag
cttgttgatcccaaagctagtcttgaaaacctagggctgaaaaatatctttaatgagaat
acatctgatttctctggaatgtcagagaccaagggagtggccctctccaatgttattcac
agagtgtgcttagagatcacggaagatggcggggattccatagaggtgcctggatcgcga
atcctgcaacacaaggatgagttcaatgccgaccacccgtttatttacatcatcaggcac
aacaaaacgcgaaacatcattttctttggcaagttctgctctccttaa

DBGET integrated database retrieval system