KEGG   Enhydra lutris kenyoni (northern sea otter): 111154402
Entry
111154402         CDS       T05871                                 

Definition
(RefSeq) nitric oxide synthase, endothelial isoform X1
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk00220  Arginine biosynthesis
elk00330  Arginine and proline metabolism
elk01100  Metabolic pathways
elk04020  Calcium signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04066  HIF-1 signaling pathway
elk04071  Sphingolipid signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04370  VEGF signaling pathway
elk04371  Apelin signaling pathway
elk04611  Platelet activation
elk04915  Estrogen signaling pathway
elk04921  Oxytocin signaling pathway
elk04926  Relaxin signaling pathway
elk04931  Insulin resistance
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    111154402
   00330 Arginine and proline metabolism
    111154402
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    111154402
   04371 Apelin signaling pathway
    111154402
   04066 HIF-1 signaling pathway
    111154402
   04020 Calcium signaling pathway
    111154402
   04071 Sphingolipid signaling pathway
    111154402
   04022 cGMP-PKG signaling pathway
    111154402
   04151 PI3K-Akt signaling pathway
    111154402
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111154402
  09152 Endocrine system
   04915 Estrogen signaling pathway
    111154402
   04921 Oxytocin signaling pathway
    111154402
   04926 Relaxin signaling pathway
    111154402
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111154402
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    111154402
   04933 AGE-RAGE signaling pathway in diabetic complications
    111154402
Enzymes [BR:elk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     111154402
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 HTH_15
Other DBs
NCBI-GeneID: 111154402
NCBI-ProteinID: XP_022369666
UniProt: A0A2Y9K8A1
LinkDB
Position
Unknown
AA seq 1211 aa
MGNLKSVGREPGPPCGLGLGLGLGLCGKQGPASPTSSEPSRAPAPAPPPAPDHSSPPLTR
PPDGPKFPRVKNWEVGSITYDTLSAQSQQDGPCTPRRCLGSLVFPRKLQSRPSQDPQPAE
QLLSQARDFINQYYSSIKRSGSQAHEQRLQEVEAEVAATGTYQLRESELVFGAKQAWRNA
PRCVGRIQWGKLQVFDARDCSSAQEMFTYICNHIKYATNRGNLRSAITVFPQRAPGRGDF
RIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDEPPE
LFALPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYMSTE
IGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINLAVLHSYQLAKVTIVDHH
AATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYVLSPAFRYQPDPWK
GSGSKGTGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQQLGRL
FRKAFDPRVLCMDEYDVVSLEHETLVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSSP
RPEQHKSYKIRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHFC
AFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQASCETFCVGEDAKAAAR
DIFSPKRSWKRQRYRLSTQAEGLQLLPGLIHVHRRKMFQATVLSVENLQSSKSTRATILV
RLDTGGQEALQYQPGDHIGICPPNRPGLVEALLSRVEDPPPPGEPVAVEQLEKGSPDLPC
TSHPSGGPPPGWVRDPRLPPCTLRQALTFFLDITSPPSPQLLRLLSTLAEESSEQQELES
LSQDPRQYEEWKWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPSAHPGE
IHLTVAVLAYRTQDGLGPLHYGVCSTWLSQLKAGDPVPCFIRGAPSFRLPPDPTLPCILV
GPGTGIAPFRGFWQERLHDIDSKGLQPAPMTLVFGCRCSQLDHLYRDEVQDAQERGVFGR
VLTAFSREPDSPKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATSVLQTVQRILA
TEGDMELDEAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERHLRGAVPWA
FDPPGPDTPSP
NT seq 3636 nt   +upstreamnt  +downstreamnt
atgggcaacttgaagagtgtgggccgggagcccgggcccccatgtggcctggggctgggc
ctgggcctggggctgtgtggcaagcagggcccggcctcccccacctcctctgagcccagc
agggcgcccgcacccgcgcccccacccgcaccagaccacagcagccccccactcacccgg
cccccggacgggcccaagttccctcgagtgaagaactgggaggtggggagcatcacctac
gataccctgagtgcccagtcacagcaggatgggccctgcaccccccgacgctgcctgggc
tcgctggtgttcccgaggaaactgcagagccggccatctcaggacccccaaccagctgag
cagctgctgagtcaggccagggacttcattaaccagtactacagctccatcaagaggagc
ggctcccaggcccatgagcagaggcttcaggaggtggaagccgaggtggcagccacgggc
acctaccagctccgggagagtgagctggtgttcggggccaagcaggcctggcgtaacgca
ccccgctgcgtgggccggatccagtgggggaagctgcaggtgttcgatgcccgggattgc
agctcagcccaggagatgttcacctacatctgcaaccacatcaagtatgccaccaaccgg
ggcaacctccgctcagccatcacagtgttcccccagcgcgccccaggccgtggagacttc
cgaatctggaacagccagctggtgcgctacgcggggtacaggcagcaggatggctcagtg
cgcggggaccccgccaacgtggagatcaccgagctctgcatccagcatggctggacccca
ggaaacggccgctttgacgtgctgccactcctgctccaggccccagatgaacccccagag
ctctttgctctgccccccgagctggtcctcgaggtgcccctggagcaccccacgctggag
tggtttgcggccctgggcctgcgctggtatgccctcccggcggtgagcaacatgctgctg
gaaattgggggcctggagttccccgcggcccctttcagcggctggtacatgagcactgag
attggcacgcggaacctgtgtgaccctcaccgatataacatcctggaggatgtggcagtc
tgcatggacttggacaccaggacaacctcatccctgtggaaagacaaggcagcggtggaa
atcaacttggccgtgctgcacagttaccagctggccaaagtgaccatcgtggaccaccac
gctgccaccgcctccttcatgaagcacctggagaacgagcagaaggctagggggggctgc
cctgccgattgggcctggatcgtgccccccatctctggcagcctcacccctgtcttccat
caggagatggtcaactacgtcctgtcccccgccttccgctatcagccagacccatggaag
gggagtggatccaagggtaccggcatcaccaggaagaagacctttaaggaagtggccaat
gcggtgaagatctcagcctcgctcatgggcaccgtgatggcaaagcgagtgaaggcgacc
atcctgtatggctccgagaccggccgggcccagagctacgcacagcaactggggagactc
ttccggaaggctttcgacccccgggtcctgtgcatggatgagtacgatgtggtgtccctt
gagcatgagacgctggtgttggtggtgaccagtacatttgggaatggtgaccccccagag
aatggagagagttttgcagcggccctgatggagatgtccggcccctacaacagctctcct
cggccagaacagcacaagagttacaaaatccgcttcaacagcgtctcctgctcagacccg
ttggtgtcctcttggaggcgaaagagaaaggagtccagtaacacagacagcgcaggggcc
ctggggaccctcaggttctgtgtgttcgggctgggctcccgggcatacccccacttctgc
gcctttgctcgtgcggtggacacacggctggaagagctgggcggggagcggctactgcag
ctgggccagggagatgagctgtgtggccaggaggaggccttccgtggctgggcccaggcc
gcattccaggcctcctgtgagactttctgcgtgggagaggatgccaaggccgctgcccgg
gacatattcagccccaaacggagctggaagcgccagcgataccggctgagcacccaggcc
gagggcctccagttgctgccaggcctgatccacgtgcacaggagaaagatgttccaggct
acggtcctctcagtggaaaacctgcaaagcagcaagtccacccgggccaccatcctagtg
cgcctagacactggaggccaggaggccctacagtaccagcccggggatcacataggcatc
tgcccgcccaaccggcccggcctcgtggaggcgctgctgagccgcgtcgaggatccgcct
ccaccgggcgagcccgtggctgtggagcagctggagaagggtagcccggacctcccctgt
acatcacacccctcaggtggcccgccccctggctgggttcgggacccccggctgccccca
tgcacgctgcgccaggctctcaccttcttcctggacatcacttccccgcccagtcctcaa
ctccttcgactgctcagcaccctggccgaagagtccagcgaacagcaggagctcgagagc
ctcagccaggacccgcggcagtacgaggagtggaagtggttccgctgccccacgctgctg
gaggtgctggagcagttcccatctgtggccctgcccgcaccgctgctcctcacccagctg
cccctgctccagccccggtactactcagtcagctcggcacccagcgcccacccaggagag
atccacctcacagtagctgtgctagcatacaggacacaggacggactgggcccccttcat
tatggagtctgctccacgtggctgagccagctgaaggccggggatcctgtaccctgcttc
atcaggggggctccctccttccggctgccgcctgaccccaccttgccctgcatcctagtg
ggccctggcacaggtattgcccccttcaggggattttggcaggagcggctgcatgacatt
gacagcaaaggcctgcagcccgcccccatgactttggtgttcggctgccgatgctcccag
ctcgaccacctttaccgcgacgaggtgcaggatgcccaggagcgcggagttttcgggcgc
gtcctcaccgccttctcccgggagcccgacagccctaagacctacgtgcaggacatcctg
cggacggagctggctgctgaggtgcaccgcgtgctgtgcctcgagcggggccacatgttt
gtgtgcggcgacgtcaccatggcaaccagcgttctgcagacggtgcagcgtatcctagcg
acggagggcgacatggagctcgacgaggccggcgacgtcatcggcgtgctgcgggatcag
caacgctatcacgaggacattttcgggctcacactgcgcacccaggaggtgacaagccgc
atacgcacccagagcttttccttgcaggagcgacatctgcggggcgcagtgccctgggcg
ttcgacccgcccgggccagacacccccagcccctga

DBGET integrated database retrieval system