KEGG   Enhydra lutris kenyoni (northern sea otter): 111154521
Entry
111154521         CDS       T05871                                 

Definition
(RefSeq) sonic hedgehog protein
  KO
K11988  sonic hedgehog
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04340  Hedgehog signaling pathway
elk04360  Axon guidance
elk05200  Pathways in cancer
elk05205  Proteoglycans in cancer
elk05217  Basal cell carcinoma
elk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    111154521
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    111154521
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111154521
   05205 Proteoglycans in cancer
    111154521
  09162 Cancer: specific types
   05226 Gastric cancer
    111154521
   05217 Basal cell carcinoma
    111154521
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:elk01002]
    111154521
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:elk00536]
    111154521
Peptidases and inhibitors [BR:elk01002]
 Cysteine peptidases
  Family C46: hedgehog family
   111154521
Glycosaminoglycan binding proteins [BR:elk00536]
 Heparan sulfate / Heparin
  Morphogens
   111154521
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Vint
Other DBs
NCBI-GeneID: 111154521
NCBI-ProteinID: XP_022369885
UniProt: A0A2Y9KKV3
LinkDB
Position
Unknown
AA seq 457 aa
MLPLGRRLLAVLVSALLLCPGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASG
RYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGV
KLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAH
IHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVRELRPGDRVLAADDQGRLLYSDFLT
FLDRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPHNDSAAGEPEARAGAGPPPGAAPG
RRALFASRVRPGQLVYVVAEGGGGRRLLPAAVHSVTLREEATGAYAPLTAQGTILINRVL
ASCYAVIEEHGWAHRAFAPFRLAHALLAVLAPSRTDRGGAGHGDGGGGGHLPLPAPGAAD
APGAAGIHWYSQLLYQIGTWLLDSEALHPLGMAVPSS
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgctgccgctggggagacgtctgctggcggtgctcgtctccgcgctgctgctgtgcccg
gggctggcgtgcggacccggcaggggatttgggaagaggcggcaccccaaaaagctgacc
cctttagcctacaagcagtttatccccaacgtggctgagaagaccctaggggccagtgga
agatatgaagggaagatctcgagaaactcggagcgatttaaggaactcacccccaattac
aaccccgacatcatatttaaggatgaagaaaacacaggagcggaccggctgatgactcag
aggtgtaaggacaagctgaatgccttggccatctcggtgatgaaccagtggcccggcgtg
aagctgcgggtgaccgagggctgggacgaagacggccaccactcagaggagtcactgcac
tacgagggccgtgccgtggacatcaccacgtcggaccgtgaccgcagcaagtacggcatg
ctggcgcgcctggccgtggaggccggcttcgactgggtgtactacgagtccaaagcccac
atccactgctccgtgaaagcagagaattcggtggcggccaagtccggcggctgcttcccg
ggctcggccacggtgcacctggagcagggcggcaccaagctggtgagagagctgcgcccc
ggggaccgcgtgctggcggccgacgaccagggccggctgctctacagcgacttcctcacc
ttcctggaccgcgacgacggcgccaagaaggtcttctacgtgatcgagacgcgggagccg
cgcgagcgcctgctgctcaccgccgcgcacctgctgttcgtcgcgccgcacaacgactcg
gcggccggggagccggaggcgcgggcgggcgcggggccgccgccgggggccgcgccgggg
cgccgggcgctcttcgccagccgcgtgcgcccgggccagctcgtgtacgtggtggcggag
ggcggcgggggtcgccggctcctgccggccgccgtgcacagcgtgacgctgcgcgaagag
gccacgggcgcgtacgcgccgctcacggcgcagggcaccatccttatcaaccgggtgctg
gcgtcgtgctacgcggtcatcgaggagcacggctgggcgcatcgggccttcgcgcccttc
cgcctggcgcacgcgctcctggccgtgctggcgccctcgcgcacggaccgcggcggggct
ggccacggcgacggcgggggcggcggccacctgcccctccccgcgccgggtgcggccgac
gcgccgggcgccgcgggcatccactggtactcgcagcttctctaccaaataggcacctgg
ttgctggacagcgaggccctgcacccgctgggcatggcggtcccgtccagctga

DBGET integrated database retrieval system