KEGG   Enhydra lutris kenyoni (northern sea otter): 111154542Help
Entry
111154542         CDS       T05871                                 

Definition
(RefSeq) IQ and AAA domain-containing protein 1-like
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
SSDB OrthologParalogGFIT
Motif
Pfam: AAA IQ AAA_5 AAA_16
Motif
Other DBs
NCBI-GeneID: 111154542
NCBI-ProteinID: XP_022369915
UniProt: A0A2Y9KKY1
LinkDB All DBs
Position
Unknown
AA seq 821 aa AA seqDB search
MSEGAYQRLWDSSHVTLQELLDQEQPLLEPVSPRERQSFQYRLSSVYLCYLGLMRRFDTL
YDQMVQPQKRRLLRRLLDSVAGRVLELKDDLVRADLSEYHCLDRVLQDLKLTPADLEVPI
PKYFLLEQSTVLKERELMLAEILSRMKPVTSEVGFPEMHRTEAIILLQRAERARQGRLRA
TFMREIRREEERDRKIREDGWHKFDQDQAAVTIQKVWKGYRQRRRTQQDRRMEMEFLGML
PLPPNQVENAGVMYQASLREDIRRVRQTEKEEEFQLAIEKTHDSIKETEGPDMKEKLKEQ
IRQWFIECHALTGRFPDYPDESVGGSYLIFADKTPEQVKMELEAEIQESKRKDQEKNKEK
EKEKKERKQKKGKKDKTRKGEADMMLKVWPSKFIPFINAGHEEYINVWKNRYENIYPKQS
FDPETLQVEKRKEVEQEIRIQVDELMRQELKNLRLVVDREEGRPLKRVKKKTGKKAGKKK
KEKDLTPDRSVDSLFEELVVSGFLRKCETVALKDYIGDYLYLGSILNLANKLPTPSLFDI
RQNVALYGVLRLGSPDIHSMAPFIRSILLVGPSGMGKKMLVKAVCTETGANLFDLSPSNL
QGKYPGKTGTQMIVHIVFKVARLLQPSVIWIGNAEKNFYKRVPKEEKEMDPKRIKKDLTK
ALRLLSPGDRVMLIGTSDQPQLAEMKGLCRTYERILFMPRPDYASRFVLWRQMIEAQGVQ
VTPNLDISALAKVSDGYTPGHILQAIHSVLTERRVLQLSKRPLVASEFLGHLAKLEPVYR
EEEESLKDWYFKTPLGKRRVKLIKDQDAGEAKLVKEKKKRK
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagggagcttaccaacgcctctgggactcctcccacgtgacccttcaagagctg
ttggaccaggagcagcccctgctggaacctgtgtcgcccagggagcggcagtcgttccag
tacaggctctcgtccgtctacctgtgctacctggggctgatgcgccggttcgacaccctc
tacgaccagatggtgcagccgcagaagcggcggctgctgcggcgcttgctggacagcgtg
gcgggccgcgtgctggagctcaaggacgacctggtgcgcgccgacctcagcgaataccac
tgtctagaccgcgtgctgcaggacctcaagctcaccccggcagacctggaggttccaatc
cccaaatactttctgttggagcagtccaccgttctgaaggagcgagagctgatgctggca
gagatcctgtccagaatgaagccagtgacctctgaggtgggttttccagaaatgcaccgg
accgaggccataatcctgctgcaaagggctgagcgggccaggcaaggtcggctccgagcc
accttcatgcgagagatacggagagaggaggagcgggatcggaagattcgagaggacggt
tggcacaagttcgatcaggaccaagcagctgtgaccatacagaaggtgtggaaaggttac
cggcagaggagacgtactcagcaggaccggcgaatggagatggagttcctcggcatgctc
cccttgccaccgaaccaggtggagaatgcgggcgtcatgtatcaagccagcctcagggag
gatatccggagggtccgccagacagagaaggaggaagagttccagttggcgatagagaag
acccatgattctatcaaagagacagaggggcctgacatgaaggagaagttgaaggagcaa
atccgacagtggtttatcgaatgccatgcccttactggtcgattccctgattatccagat
gaatctgtaggtggatcctacctgatctttgcagacaagactccagaacaggtaaaaatg
gaactggaggcagagatccaggagagcaaaagaaaggaccaagagaaaaataaggaaaaa
gaaaaggagaaaaaagaaaggaagcagaagaaagggaagaaagacaagaccaggaagggg
gaggcagacatgatgctgaaagtgtggccatccaagttcatacctttcatcaatgccgga
catgaggagtacataaatgtgtggaagaaccggtatgagaatatatacccgaaacagagt
tttgaccccgagacactccaggtggagaagagaaaggaagtagagcaggagatccggata
caggtggatgagctgatgcgccaagagctgaagaacctgcgcctggttgtggacagggag
gaggggagacccttgaagcgtgtgaagaaaaagactgggaagaaagccgggaagaagaag
aaggaaaaagatctgaccccagacaggtccgtggactctctgtttgaagagctcgttgtc
tccggctttctaagaaagtgcgagacagtggccttgaaagattacattggtgactacctc
tatcttggatccattctgaacctggcgaacaagttgcctacaccttccctgtttgacata
agacagaatgtggccttgtacggggtccttcgccttggctccccagatatacactccatg
gcccccttcatccgctccatcctcctggtgggcccctctggaatggggaagaagatgctg
gtcaaggccgtgtgcacagaaacgggcgccaacctctttgacctgtcccccagcaacctg
cagggcaaatatcctggcaagacggggacacagatgatcgtgcatatcgtctttaaggtg
gctcggctcttacagccctctgtgatctggattgggaatgccgagaagaatttctataag
agggtcccaaaagaagagaaggagatggacccaaagcgaataaagaaggatctcaccaag
gccttgcgactgctgagcccaggagaccgcgtgatgctgatagggacgagtgaccagccg
cagctggcggagatgaaggggctgtgccggacctacgaacggatcctcttcatgccacgg
cccgattacgcttctcgcttcgtgctctggaggcagatgatagaggcccagggggtccag
gtgaccccgaacctagacatcagcgccctggccaaggtgtccgatggctacacacccggt
cacattctccaagccatccactccgtgctgaccgagaggcgggtcctgcagctgtccaag
cggcccctggtggcctcagagttcttagggcacctggccaagctggagccagtgtacagg
gaggaggaggagtccctgaaggactggtacttcaagactccactgggcaagaggagggta
aaactcatcaaggaccaggacgctggggaagccaagctggtgaaggagaagaagaaaagg
aagtga

DBGET integrated database retrieval system