KEGG   Enhydra lutris kenyoni (northern sea otter): 111154804
Entry
111154804         CDS       T05871                                 

Definition
(RefSeq) tumor protein p73
  KO
K10148  tumor protein p73
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04115  p53 signaling pathway
elk04390  Hippo signaling pathway
elk04722  Neurotrophin signaling pathway
elk05162  Measles
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    111154804
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    111154804
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111154804
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    111154804
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111154804
Transcription factors [BR:elk03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    111154804
SSDB
Motif
Pfam: P53 P53_tetramer SAM_2 SAM_1
Other DBs
NCBI-GeneID: 111154804
NCBI-ProteinID: XP_022370431
UniProt: A0A2Y9KAG1
LinkDB
Position
Unknown
AA seq 637 aa
MAQPTSTDEGATFEHLWSSLEPDSTYFDLPQSSQGNNEVVGGPEAGMDVYHLQGMTTPVM
SQFNLLSSTMDQMSGRAAPASPYTPEHTASVPTHSPYAQPSSTFDTMSPAPAIPSNTDYP
GPHHFDVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTIIRAMPVYK
KAEHVTEVVKRCPNHELGRDFNEGQSAPASHLIRVEGNSLSQYVDDPVTGRQSVMVPYEP
PQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLETRDGQVLGRRSFEGRICACPGRDR
KADEDHFREQQALSESATKNGATSKRAFKQSPPAVPALGTNVKKRRQGDEDVYYMHVRGR
ENFEILMKVKESLELMELVPQQLVDAYRQQQQQLLQRPSHLQPAPYGPVLSPMNKAHGGV
NKLPSVSQLVGQPPPHGSAAGPNLGPMGPGILNNHGHALPTGSEMNGSHSAQSMVSGSHC
TPPPPYHADPSLVSFLTGLGCPNCIEYFTSQGLQSVYHLQNLTVEDLGALKIPDQYRMTI
WRGLQDLKQSHDCGAQQLIRSSSNASTISIGSSGELQRQRVMEAVHFRVRHTITIPNRGG
PGGGAGPDEWADFGFDLPDCKSRKQSIKEEFTESEIH
NT seq 1914 nt   +upstreamnt  +downstreamnt
atggcccagccgacctccacagatgagggggccacattcgagcatctctggagctccctg
gaaccagacagcacctactttgaccttccccagtccagccaaggaaacaacgaggtggtg
ggcggcccagaggctggcatggatgtctatcacctgcagggcatgaccacgcctgtcatg
tcccagttcaatctgctgagcagcaccatggaccagatgagcggccgcgcggccccggcc
agcccctacaccccggagcacacggccagcgtgcccacccactcgccctacgcgcagccc
agctccaccttcgacaccatgtcgcccgcaccggccatcccctccaacaccgactacccc
ggcccccaccactttgacgtcaccttccagcagtccagcacggccaagtcagctacctgg
acgtactccccactgctgaagaagctctactgccagatcgccaagacctgccccatccag
atcaaggtgtccaccccgccgcccccgggcaccatcatccgggccatgcccgtctacaag
aaggcggagcacgtgaccgaggtcgtgaagcgctgccccaaccatgagctcgggcgggac
ttcaacgagggacagtctgctccagccagccacctcatccgcgtggagggcaacagcctc
tcccagtacgtggacgaccccgtcacgggcaggcagagcgtcatggttccctacgagccc
ccgcaggtggggacagaattcacgaccatcctgtacaacttcatgtgcaacagcagctgt
gtggggggcatgaaccgacgacccatcctcatcatcatcacgctggagacccgggacgga
caggtgctgggccgccggtcctttgagggccgcatctgcgcctgtcctggccgagaccgc
aaggctgacgaagaccacttccgggagcagcaggccctgagcgagagcgccaccaagaac
ggcgccaccagcaagcgcgccttcaaacagagcccccctgccgtccctgccctgggcacc
aacgtgaagaagaggaggcagggggacgaggacgtgtactacatgcacgtgcggggccgg
gagaacttcgagatcctgatgaaggtgaaggagagcctggagctgatggagctggtgcca
cagcagctggtggacgcgtaccggcagcaacagcagcagctcctgcagcggccgagccac
ctgcagccagcgccctatgggcccgtcctgtcacccatgaacaaagcgcacgggggcgtc
aacaagctgccctccgtcagccagctggtgggtcagccgcccccgcacggctcagcggcc
gggcccaacctggggcccatgggccccgggattctcaacaaccatggccacgccctgccg
accggcagtgagatgaacggcagccacagtgcccagtccatggtctcggggtcccactgc
accccaccacccccctaccacgctgaccccagtctggtcagtttcctcacgggactgggg
tgtccgaactgcatcgagtacttcacgtcccagggcctgcagagcgtctaccacctgcag
aacctcaccgtcgaggatctcggcgccctgaagatcccggaccagtaccgcatgaccatc
tggagaggcctgcaggacctgaagcagagccacgactgtggcgcccagcagctgatccgc
tccagcagcaacgcctccaccatctccatcggcagctccggggagctgcagcggcagcgg
gtcatggaggccgtgcacttccgcgtgcgccacaccatcaccatccccaaccgcgggggc
ccgggcgggggtgcggggcctgacgaatgggccgactttggcttcgacctcccggactgc
aagtcccgaaaacagtccatcaaagaggagttcacggagagcgagattcactga

DBGET integrated database retrieval system