KEGG   Enhydra lutris kenyoni (northern sea otter): 111154862
Entry
111154862         CDS       T05871                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: tyrosine-protein phosphatase non-receptor type 11-like
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04014  Ras signaling pathway
elk04072  Phospholipase D signaling pathway
elk04360  Axon guidance
elk04625  C-type lectin receptor signaling pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk04670  Leukocyte transendothelial migration
elk04722  Neurotrophin signaling pathway
elk04920  Adipocytokine signaling pathway
elk04931  Insulin resistance
elk05168  Herpes simplex virus 1 infection
elk05205  Proteoglycans in cancer
elk05211  Renal cell carcinoma
elk05220  Chronic myeloid leukemia
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    111154862
   04630 JAK-STAT signaling pathway
    111154862
   04072 Phospholipase D signaling pathway
    111154862
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111154862
   04650 Natural killer cell mediated cytotoxicity
    111154862
   04670 Leukocyte transendothelial migration
    111154862
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111154862
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111154862
  09158 Development and regeneration
   04360 Axon guidance
    111154862
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    111154862
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111154862
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    111154862
   05211 Renal cell carcinoma
    111154862
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    111154862
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111154862
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:elk01009]
    111154862
Enzymes [BR:elk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     111154862
Protein phosphatases and associated proteins [BR:elk01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    111154862
SSDB
Motif
Pfam: Y_phosphatase SH2
Other DBs
NCBI-GeneID: 111154862
NCBI-ProteinID: XP_022370505
UniProt: A0A2Y9KMK7
LinkDB
Position
Unknown
AA seq 711 aa
MRLSRLSAAERRRLARLGLAGSRPPRAIALRARDARVDPLVLKFGAPSNTVDSIPTSTRR
RRSLLATGFGFCQVQAPRGRVRVGQDFGSPEGTQLSPQLCSVATCGARSTWFHPNISAVE
AEKLLLSGGQHGSFLVRPSKSCPGASHQSVRRHSEVAHINVQNTGDYYDLYGVEKFAALG
ELVHHYTGQRGGLLRERSGAPVELRQPLGYQDPVSDRWYHGHLSGKEAEQLLMEKGRPGT
FLVQESQGKPGGFVLSVLTPRPEKAHLQPQVTHISIHFWVRRDGKYDVGGGQEFDSLADL
LERYRRSPRPERSGPPCXVWTQRSPGRPLKAARINAASIESRVQELSGPTGARGKAKQGF
WEEFEMLQQQECRLLYPREEGQRLENKPKNRYKNILPFDTTRVTLCDVDDTVPGADYINA
NYIRSDPEKPGHGPGKVYIATQGCLQSTVAAFWAMVHQENTRVIVMATREVERGRLMXCT
PPPRNKCFRYWPQLQGSQEYGRVRIFNLAEYQAQGYCLWELQVWRPDQEEPRRTVKHYQY
FSWPDHGVPAEPSGVLGFLDEVNRAQSSMPGAGPMVVHCSHRPQVGPHCAGIGRTGTIVV
IDILVDLIRRQGLHCDIDVPRTIQLVRRQRSGMVQTEAQYEFVHLALQRHIQAEQLRLRE
QRRPPEEPYYLNVGLGSADPGRNAAPVSSRAPAAIPEATGGEYENLRSPAR
NT seq 2136 nt   +upstreamnt  +downstreamnt
atgcgtttatcacggttaagcgccgctgagcgcaggcggctggccaggctggggctcgcc
gggtcccggccgccccgcgccatcgccctgcgagcccgggacgcccgcgtggatcccctg
gttctcaagtttggcgcgccctcgaacactgtcgactccatcccaacttctacgcggagg
agacgctcccttctggccactggatttgggttctgccaggtgcaggccccaaggggcagg
gtgcgtgtgggccaggactttgggagcccagagggcactcagttgtcaccccagctctgc
agcgtggccacttgtggtgctcgttccacatggtttcaccctaacatcagtgcagttgag
gcagagaagctgctcctgtccgggggccagcacgggagcttcctggtgagacccagcaag
agctgccccggggcttcacaccaatctgttaggcgccacagtgaggtagcccacatcaat
gtccagaacacgggcgactactacgatctctacggagtggagaagttcgctgctctgggc
gagctggtgcaccactacacaggccagcgtggggggctgctccgtgagcgcagcggggcc
cccgtagagctccggcagccactgggctaccaggaccctgtctctgatcggtggtaccac
ggacacctgtctggcaaggaggccgagcagctgctgatggaaaaaggccgtccgggcacc
ttcctggtgcaggaaagtcagggcaagcctgggggcttcgtgctgtccgtgctcacaccg
aggcctgagaaggcccacctccagccgcaggtcacacacatctcgatccacttctgggtg
aggcgtgatgggaagtacgacgtgggaggagggcaagagttcgactccctcgctgacctg
ctggagcgctacaggaggagcccgaggccggagaggtccggaccaccctgctaagtgtgg
acgcagcgctctcccggccggcccctcaaagcagcgaggatcaacgccgcgagcattgag
agccgagtgcaagagctcagcgggcccactggtgcccgcgggaaggccaagcagggcttc
tgggaagaatttgagatgctgcagcagcaggaatgtcggctcctgtacccccgggaggag
gggcagcggctggagaacaagcccaagaatcgctacaagaacatccttccctttgatacc
acgcgtgtcactctgtgtgatgtggacgacaccgtgcctggagccgactacatcaacgcc
aactacatcaggagcgatccggagaagccaggtcacggaccgggcaaggtgtacatcgcc
acccagggctgtctgcaaagcacagtggctgccttctgggcaatggtgcaccaggagaac
acgcgggtcattgtcatggccacgagggaggtggagcgaggccggctgatgtgatgcacc
ccccccccgcggaacaaatgcttccggtactggccccagctgcagggcagccaagaatat
ggccgtgtgcgtattttcaacttggcagagtaccaagcccagggctactgcttatgggaa
ctacaggtgtggcggccagatcaggaggagccgcggcgcacagtgaagcactaccagtac
ttcagctggccagaccacggggtcccggccgagccctccggcgtcctcggcttcctggat
gaggtgaacagggcccagagcagcatgccgggggctggacccatggtggtgcactgcagc
cacaggccccaggtcggtccccactgcgccggcatcggacgcactggcaccatcgtcgtg
attgacatcctggtggacctcatccgcaggcagggtctgcactgcgacatcgacgtgccc
aggaccatccagctggtgcggcggcagcgctcggggatggtgcagaccgaggcgcagtac
gagttcgtgcacctggcgctgcagcggcacatccaggccgagcagctgcgcctgcgcgag
cagcgccggccgccggaggagccctactacctgaacgtgggcctcgggtcggcggacccc
ggccgcaacgctgcccccgtgtcgtctcgggcgccggcggcgatcccagaggcgaccggc
ggcgagtacgagaacctgcggagcccggcgcggtga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111156454
Entry
111156454         CDS       T05871                                 

Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 11
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04014  Ras signaling pathway
elk04072  Phospholipase D signaling pathway
elk04360  Axon guidance
elk04625  C-type lectin receptor signaling pathway
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk04670  Leukocyte transendothelial migration
elk04722  Neurotrophin signaling pathway
elk04920  Adipocytokine signaling pathway
elk04931  Insulin resistance
elk05168  Herpes simplex virus 1 infection
elk05205  Proteoglycans in cancer
elk05211  Renal cell carcinoma
elk05220  Chronic myeloid leukemia
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    111156454
   04630 JAK-STAT signaling pathway
    111156454
   04072 Phospholipase D signaling pathway
    111156454
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111156454
   04650 Natural killer cell mediated cytotoxicity
    111156454
   04670 Leukocyte transendothelial migration
    111156454
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111156454
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111156454
  09158 Development and regeneration
   04360 Axon guidance
    111156454
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    111156454
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111156454
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    111156454
   05211 Renal cell carcinoma
    111156454
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    111156454
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111156454
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:elk01009]
    111156454
Enzymes [BR:elk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     111156454
Protein phosphatases and associated proteins [BR:elk01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    111156454
SSDB
Motif
Pfam: Y_phosphatase SH2 DSPc Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 111156454
NCBI-ProteinID: XP_022373082
UniProt: A0A2Y9KGY6
LinkDB
Position
Unknown
AA seq 593 aa
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTG
DYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGK
EAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYD
VGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETT
DKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEP
VSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEV
ERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRELKLSKVGQGNTERTVWQYHF
RTWPDHGVPSDPGGVLDFLEEVHHKQESIMDAGPVVVHCSAGIGRTGTFIVIDILIDIIR
EKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSKRKGH
EYTNIKYSLTDQTSGDQSPLPPCTPTPSCAEMREDNARVYENVGLMQQQKSFR
NT seq 1782 nt   +upstreamnt  +downstreamnt
atgacatcgcggagatggtttcacccaaacatcactggcgtggaggccgaaaacctgctg
ttgacaagaggcgttgatggcagttttttagcgaggcccagtaaaagcaaccctggagac
ttcaccctttccgtcagaagaaatggcgccgtcacccacatcaagattcagaacactggt
gattactatgacctgtacggaggagagaagtttgccactttggctgagttggtccagtat
tatatggaacatcatgggcaattaaaagagaagaatggagatgttattgagcttaaatat
cctctgaactgtgcagatcctacctctgaaaggtggtttcatggacacctctctgggaaa
gaagcagagaaattactaacggagaaaggaaaacatggtagctttctggtacgagagagc
cagagtcaccccggagattttgttctttctgtccgaactggtgacgacaaaggggagagc
aatgatggcaagtcgaaagtgacccacgtcatgatccgctgtcaggaactgaaatatgat
gttggtggaggagaacggtttgactctttgacagatcttgtggagcattacaagaagaat
cccatggtggaaacactgggcacagtactacaactcaagcagcccctcaacacaacacgt
atcaatgctgctgaaatagaaagccgggttcgagagctaagcaaattagctgagaccaca
gataaagtcaaacaaggcttttgggaagaatttgagacactacaacagcaggagtgcaaa
cttctctacagccgaaaagagggtcagaggcaagaaaataagaacaaaaatagatacaaa
aacatcctgccctttgatcataccagggttgtcctacacgatggcgatcccaatgagccc
gtttcagattacatcaatgcaaatattatcatgcctgagtttgaaaccaaatgcaacaat
tcaaagcccaaaaagagttacattgccacgcaaggctgcttgcaaaacacggtgaatgac
ttttggcggatggtatttcaagagaactcccgagtgattgtcatgacaacgaaagaagtg
gagagaggaaagagtaaatgtgtcaaatactggcccgacgagtatgctctgaaagaatat
ggggtcatgcgtgttaggaacgtcaaagaaagtgctgctcatgactatacattaagagaa
cttaaactttcaaaggttggacaagggaatacagagagaaccgtgtggcaataccacttt
cggacctggccggaccacggagtgcccagtgaccctgggggcgtgctggacttcttggag
gaggtccaccataagcaagaaagcattatggacgcagggcctgtggtcgttcactgcagt
gctggaattggccggacagggacgttcattgtgattgatatccttattgacatcatcaga
gagaaaggtgtcgactgtgacattgatgttcccaaaaccattcagatggtgcggtctcag
aggtcagggatggtccagacagaagcacagtataggttcatctatatggctgtccagcat
tacatcgaaacactacagcgcaggattgaagaagaacagaaaagcaagaggaaagggcat
gaatatacaaatattaagtattctctaacggaccagacaagtggagatcagagtcccctc
ccgccttgtaccccaacaccatcttgtgcagaaatgagagaagataatgctagagtctat
gaaaatgtgggtctgatgcagcagcagaaaagtttcagatga

DBGET integrated database retrieval system