KEGG   Enhydra lutris kenyoni (northern sea otter): 111154869
Entry
111154869         CDS       T05871                                 

Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04061  Viral protein interaction with cytokine and cytokine receptor
elk04151  PI3K-Akt signaling pathway
elk04625  C-type lectin receptor signaling pathway
elk04630  JAK-STAT signaling pathway
elk04658  Th1 and Th2 cell differentiation
elk04659  Th17 cell differentiation
elk04660  T cell receptor signaling pathway
elk04672  Intestinal immune network for IgA production
elk04940  Type I diabetes mellitus
elk05135  Yersinia infection
elk05142  Chagas disease
elk05162  Measles
elk05166  Human T-cell leukemia virus 1 infection
elk05200  Pathways in cancer
elk05320  Autoimmune thyroid disease
elk05321  Inflammatory bowel disease
elk05330  Allograft rejection
elk05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111154869
   04151 PI3K-Akt signaling pathway
    111154869
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111154869
   04061 Viral protein interaction with cytokine and cytokine receptor
    111154869
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111154869
   04660 T cell receptor signaling pathway
    111154869
   04658 Th1 and Th2 cell differentiation
    111154869
   04659 Th17 cell differentiation
    111154869
   04672 Intestinal immune network for IgA production
    111154869
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111154869
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111154869
   05321 Inflammatory bowel disease
    111154869
   05330 Allograft rejection
    111154869
   05332 Graft-versus-host disease
    111154869
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111154869
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    111154869
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111154869
   05162 Measles
    111154869
  09174 Infectious disease: parasitic
   05142 Chagas disease
    111154869
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111154869
   00536 Glycosaminoglycan binding proteins [BR:elk00536]
    111154869
Cytokines and growth factors [BR:elk04052]
 Cytokines
  Interleukins
   111154869
Glycosaminoglycan binding proteins [BR:elk00536]
 Heparan sulfate / Haparin
  Cytokines
   111154869
SSDB
Motif
Pfam: IL2
Other DBs
NCBI-GeneID: 111154869
NCBI-ProteinID: XP_022370514
UniProt: A0A2Y9KGA6
LinkDB
Position
Unknown
AA seq 155 aa
MYKMQLLSCIVLTLALVANSAPTTSSSTKEAQQQLEQLLLDLQLLLNGVNNYESLKLPRM
LTFKFYMPKKATELTHLQCLAEELKLLEEVLYLAQSKNFHLTDIKELMSNINVTLLKLKG
SETSFKCEYDDETVTITEFLNKWITFCQSIFSTLT
NT seq 468 nt   +upstreamnt  +downstreamnt
atgtacaaaatgcaactcttgtcttgcatcgtactgactctcgcactcgtcgcaaacagt
gcacctactacttcaagctctacgaaggaagcacagcaacagctggagcaattgctgctg
gacttacagttgctcttgaatggggttaataattatgagagcctcaaactccccaggatg
ctcacatttaaattctacatgcccaagaaggccacagaattgactcatcttcaatgtcta
gcagaagaactcaaacttttggaggaagtgctatatttagctcaaagcaaaaactttcac
ttgacagacatcaaggaactaatgagcaatatcaatgtaacacttctgaaactaaaggga
tctgaaacaagtttcaaatgtgaatatgatgacgagacagtaaccattacagaatttctg
aacaaatggattactttttgtcaaagcatcttctcaacactgacttga

DBGET integrated database retrieval system