KEGG   Enhydra lutris kenyoni (northern sea otter): 111154883
Entry
111154883         CDS       T05871                                 

Definition
(RefSeq) serine/threonine-protein kinase mTOR
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk01522  Endocrine resistance
elk04012  ErbB signaling pathway
elk04066  HIF-1 signaling pathway
elk04072  Phospholipase D signaling pathway
elk04136  Autophagy - other
elk04140  Autophagy - animal
elk04150  mTOR signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04152  AMPK signaling pathway
elk04211  Longevity regulating pathway
elk04213  Longevity regulating pathway - multiple species
elk04218  Cellular senescence
elk04371  Apelin signaling pathway
elk04613  Neutrophil extracellular trap formation
elk04630  JAK-STAT signaling pathway
elk04659  Th17 cell differentiation
elk04714  Thermogenesis
elk04910  Insulin signaling pathway
elk04919  Thyroid hormone signaling pathway
elk04920  Adipocytokine signaling pathway
elk04930  Type II diabetes mellitus
elk04931  Insulin resistance
elk04935  Growth hormone synthesis, secretion and action
elk05010  Alzheimer disease
elk05014  Amyotrophic lateral sclerosis
elk05016  Huntington disease
elk05017  Spinocerebellar ataxia
elk05022  Pathways of neurodegeneration - multiple diseases
elk05163  Human cytomegalovirus infection
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05170  Human immunodeficiency virus 1 infection
elk05200  Pathways in cancer
elk05205  Proteoglycans in cancer
elk05206  MicroRNAs in cancer
elk05210  Colorectal cancer
elk05212  Pancreatic cancer
elk05214  Glioma
elk05215  Prostate cancer
elk05221  Acute myeloid leukemia
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
elk05230  Central carbon metabolism in cancer
elk05231  Choline metabolism in cancer
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111154883
   04371 Apelin signaling pathway
    111154883
   04630 JAK-STAT signaling pathway
    111154883
   04066 HIF-1 signaling pathway
    111154883
   04072 Phospholipase D signaling pathway
    111154883
   04151 PI3K-Akt signaling pathway
    111154883
   04152 AMPK signaling pathway
    111154883
   04150 mTOR signaling pathway
    111154883
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111154883
   04136 Autophagy - other
    111154883
  09143 Cell growth and death
   04218 Cellular senescence
    111154883
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    111154883
   04659 Th17 cell differentiation
    111154883
  09152 Endocrine system
   04910 Insulin signaling pathway
    111154883
   04920 Adipocytokine signaling pathway
    111154883
   04935 Growth hormone synthesis, secretion and action
    111154883
   04919 Thyroid hormone signaling pathway
    111154883
  09149 Aging
   04211 Longevity regulating pathway
    111154883
   04213 Longevity regulating pathway - multiple species
    111154883
  09159 Environmental adaptation
   04714 Thermogenesis
    111154883
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111154883
   05206 MicroRNAs in cancer
    111154883
   05205 Proteoglycans in cancer
    111154883
   05230 Central carbon metabolism in cancer
    111154883
   05231 Choline metabolism in cancer
    111154883
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111154883
  09162 Cancer: specific types
   05210 Colorectal cancer
    111154883
   05212 Pancreatic cancer
    111154883
   05225 Hepatocellular carcinoma
    111154883
   05226 Gastric cancer
    111154883
   05214 Glioma
    111154883
   05221 Acute myeloid leukemia
    111154883
   05215 Prostate cancer
    111154883
   05224 Breast cancer
    111154883
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111154883
   05014 Amyotrophic lateral sclerosis
    111154883
   05016 Huntington disease
    111154883
   05017 Spinocerebellar ataxia
    111154883
   05022 Pathways of neurodegeneration - multiple diseases
    111154883
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111154883
   04931 Insulin resistance
    111154883
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111154883
   05168 Herpes simplex virus 1 infection
    111154883
   05163 Human cytomegalovirus infection
    111154883
   05167 Kaposi sarcoma-associated herpesvirus infection
    111154883
   05165 Human papillomavirus infection
    111154883
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111154883
   01522 Endocrine resistance
    111154883
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111154883
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:elk04131]
    111154883
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111154883
Protein kinases [BR:elk01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   111154883
Membrane trafficking [BR:elk04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    111154883
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 V-ATPase_H_N UME HEAT_EZ Nipped-B_C
Other DBs
NCBI-GeneID: 111154883
NCBI-ProteinID: XP_022370529
UniProt: A0A2Y9KGB8
LinkDB
Position
Unknown
AA seq 2550 aa
MLGTGPAAATAAATTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPPQSNALVGLLGYSSHQGLMGFGASPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTALPEASDVGGITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSVHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFITIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEVPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRPTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAVATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITSTTTAATTAATATATATSTEGSNSESEAESTENS
PTPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDV
NEALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVA
SKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYF
GERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQ
AWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPS
LQVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKN
LSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLT
LMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDR
HPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRIT
CHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILD
GVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDETL
DVPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7653 nt   +upstreamnt  +downstreamnt
atgctgggaaccggacccgctgccgccaccgcagccgccaccacatctagcaatgtgagc
gtcctgcagcagttcgccagtggcctgaagagccggaatgaggagaccagggccaaagcc
gccaaggagctccagcactatgtgaccatggagctgcgagagatgagtcaggaggagtct
actcgcttctatgatcagctgaaccatcacatttttgaactggtttccagctcagatgcc
aatgagaggaaaggtggcatcttggccatagccagcctcataggagtggaaggtgggaat
gccactcgcatcggcagattcgctaactatcttcggaacctcctcccctcgaatgaccca
gttgtcatggagatggcatccaaggccattggccgcctcgccatggcaggtgacactttt
acggctgagtatgtggagtttgaggtgaagcgagccttggagtggctgggcgccgaccgc
aacgagggccggagacacgccgctgttctggttctccgtgagctggccatcagcgtcccc
actttcttcttccagcaagtgcagcccttctttgacaacatttttgtggccgtgtgggac
cccaaacaggccatccgagagggagccgtagccgcccttcgtgcctgtttgattctcacc
acccagcgtgagccaaaggagatgcagaagcctcagtggtaccggcacacatttgaagaa
gcagagaaagggtttgatgagacattggccaaggagaagggcatgaaccgggatgatcgc
atccatggagccttgctcatcctcaacgagttggtccgcatcagcagcatggagggagag
cgcctgagagaagaaatggaagaaatcacacagcagcagctggtgcatgacaagtactgc
aaggacctcatgggcttcggcacgaaaccgcgccacatcactccctttaccagtttccag
gctgtccagccccctcagtccaacgccttggtgggactgctggggtacagctctcaccaa
ggcctcatggggtttggggcttcccccagcccagcaaaatctaccctggtggagagtcgg
tgttgtagagacctgatggaggagaaatttgaccaggtgtgccagtgggtgctgaaatgc
aggaatagcaagaactcgctgatccagatgacaatccttaatttgttgccccgcctggcc
gcgtttcgaccttctgccttcacagatacccagtacctccaagataccatgaaccatgtc
ttaagctgtgtcaagaaggagaaggaacgtacagcagccttccaagccctggggctgctc
tctgtggctgtgagatctgagtttaaggtctatttacctcgggtgctggacatcatccgt
gcagccctaccccctaaggactttgcccataagagacagaaggccatgcaggtagatgcc
acagtgttcacctgtatcagcatgctggcccgggcgatggggccaggcatccaacaggat
atcaaggagctgctggagcccatgctggcagtgggactgagccctgccctcactgctgtg
ctgtatgacctgagccgacagattccacagctgaagaaggacatccaggatgggctcctg
aagatgctgtccctggtcctaatgcacaaacccctccggcacccgggcatgcccaagggc
ctggcccatcagctggcttcccctggcctcacagccctgcctgaggccagtgatgtgggt
ggcattactctggctctgcgtactcttggcagcttcgagttcgaaggccactctctgacc
cagttcgtccgccactgtgcggatcatttcctaaacagcgagcacaaggagatccgcatg
gaagctgcccgtacctgctcccgcctgctcacaccctccgtccacctcatcagcggccac
gctcatgtggtcagccagaccgcagtgcaggtggtggcagacgtgctcagcaagctgctc
gtggttgggataacagatcctgaccctgacatccgctactgtgtcttggcatccctggat
gagcgcttcgatgcccacctggcccaggcagagaatttgcaggccctgtttgtggccctg
aacgaccaggtgtttgagatccgggagctggccatctgcaccgtggggcggctcagcagc
atgaacccggccttcgtcatgcctttcctgcgtaagatgctcatccagattctgacagag
ctggagcacagtggcattggaagaatcaaagaacagagtgcccgcatgctggggcacctg
gtctccaatgccccccggctcatccgcccctacatggagcccattctgaaggctttaatt
ttgaaactgaaagatccggaccctgatccaaacccaggtgtgatcaacaatgtcttggct
acgataggagaattggctcaggttagtggcctagaaatgaggaagtgggtggacgaactc
ttcattaccatcatggacatgctgcaggactcctctctgttggccaaaaggcaggtggct
ctgtggaccctgggacagttagtggccagcactggctatgtggtggagccctacaggaaa
taccccactttgcttgaggtcctgctgaattttctgaagactgagcagaaccaggggaca
cggagagaggctatccgtgtgttagggcttttaggggccctggatccctacaagcacaaa
gtgaacattggcatgattgaccagtcccgcgatgcttctgctgtcagcctttctgaatcc
aagtcaagtcaggattcctccgactacagcaccagcgagatgctggtcaacatgggcaac
ctgccgctggatgagttctaccccgccgtgtccatggtggcgctgatgcggatcttccga
gaccagtccctgtcgcaccatcacaccatggtcgtccaggccatcaccttcatcttcaag
tccctgggcctcaagtgtgtacagttcctgccgcaggtcatgcccacattcctcaatgtc
attcgggtctgcgacggggccatccgggagttcctgttccagcagctggggatgctggtg
tccttcgtgaagagccacatccgaccttacatggatgaaatagtcacccttatgagagaa
ttctgggtcatgaatacctcaatccagagcacaatcatccttcttattgagcaaattgtg
gtagctcttgggggtgaatttaagctctacctgccccagctgatcccacacatgctacgc
gtcttcatgcacgacaacagcccaggccgcatcgtctccatcaagctgttggctgccatc
cagctgttcggcgccaacctggacgactatctgcacttgttgcttcctcctatcgtgaag
ctctttgacgccccggaagttccgctgccatctcggaaggcagcattagagacagtggac
cgcctgacggagtcgctggacttcactgactatgcgtcccgcatcatccatccgattgtt
cgaacgctggaccagagcccggaactgcgtcccacggccatggacacgttgtcttcgctg
gtcttccagttggggaagaagtaccagattttcattccaatggtgaacaaagtcctggtg
cgacaccgaatcaaccatcagcgctacgacgtcctcatctgcagaatcgtgaagggatac
acactagctgatgaagaagaggaccccttgatttaccagcaccgaatgctgaggagtggc
caaggggatgcattggctagtgggccggtcgaaacgggacccatgaagaaactgcacgtc
agcaccatcaatctccaaaaggcctggggagctgccaggagggtctccaaagatgactgg
ctggagtggctgagacgactgagtctggagctcctgaaggactcctcatcgccttctctg
cgctcgtgctgggccctggctcaggcctacaacccaatggccagggatctttttaatgct
gcatttgtgtcctgctggtctgagctgaatgaagaccagcaggatgaactcatcagaagc
atcgagttggccctcacctcgcaggacattgctgaagtcacgcagaccctcttaaacttg
gccgaattcatggaacacagtgataagggccccctgcccttgagagacgacaacggcatt
gtcctgctcggggagagagccgccaagtgccgggcctacgccaaagcactgcactacaaa
gaactggagttccagaaagggcccacccccgccatcctcgaatctctcatcagcattaac
aataagctacagcagccagaggcagccgccggggtgctagagtacgccatgaaacacttc
ggagagctggagatccaggctacctggtacgagaaactgcatgagtgggaggacgcgctc
gtggcctacgataagaagatggacacgaacaaggacgaccccgagctgatgctgggccgc
atgcgttgcctcgaggccctgggagagtgggggcagctccaccagcagtgctgtgaaaag
tggaccctggttaatgatgagacccaagccaagatggcccgcatggctgccgcagctgcc
tggggtctaggtcagtgggacagcatggaggaatacacctgcatgatccctcgggacacg
cacgatggcgcgttctacagagccgtgctggcgctgcatcaggacctcttctccttggca
caacagtgcattgacaaagccagagacctgctggatgccgagttaaccgctatggcagga
gagagctacagtcgggcatatggggccatggtctcttgccacatgctctccgagctggag
gaggtcatccagtacaaacttgtcccggagcgacgggagatcatccgccagatctggtgg
gagaggctgcagggctgccagcgcatcgtggaggactggcagaagatcctgatggtgcgg
tcacttgtggtcagccctcatgaggacatgaggacctggctcaagtatgccagcctgtgt
gggaagagcggcaggctggcccttgctcataaaaccttagtgttgctcctgggagtggat
ccatctcggcaactggaccatcctctgccaacagttcaccctcaggtgacctacgcctac
atgaaaaacatgtggaagagcgctcgcaagattgacgccttccagcacatgcagcacttc
gtgcagaccatgcagcagcaggcccagcacgccgttgccaccgaggaccagcagcacaag
caggagctgcacaagctcatggcccggtgtttcctgaagctcggggagtggcagctgaac
ctgcagggcatcaacgagagcaccatccccaaggtgctgcagtactacagcgcggccacg
gagcacgaccgcagctggtacaaggcctggcacgcgtgggcagtgatgaactttgaagct
gtgctgcactacaagcatcagaaccaagcgcgtgacgagaagaagaagctgcggcatgcc
agcggggccaacatcaccagcacgaccaccgccgccaccaccgcggccacggccaccgcc
accgccaccagcaccgagggcagcaacagtgagagcgaggccgagagcaccgagaacagc
cccaccccgtctcctctgcagaagaaggtcactgaggatttgtccaaaaccctgctgatg
tacaccgtccctgccgtccagggcttcttccgctccatctccttgtcacgaggcaacaac
ctccaggacacactgagagtcctcaccttatggtttgactatggtcactggccagatgta
aatgaagccttagtggaaggggtgaaagcgatccagatcgatacttggttacaggtcata
ccgcagctcatcgcgagaatcgatacacccaggcccttggtgggccgcctcattcaccag
cttctcacagacattggccggtaccacccccaggccctcatctacccactgactgtggcc
tctaagtccaccacgacggcccgccacaacgcagccaacaagatcctgaagaacatgtgc
gagcacagtaacaccctggtccagcaggccatgatggtgagcgaggagctcatccgcgtg
gccatcctctggcacgagatgtggcacgaaggcctggaagaggcctcccgtttgtacttc
ggggagaggaacgtgaagggcatgttcgaggtgctggagcccctgcacgccatgatggag
cggggcccccagactctgaaggaaacatcttttaatcaggcatatggtcgagacctaatg
gaggcccaagagtggtgcaggaagtacatgaaatccgggaacgtcaaggaccttacccaa
gcctgggacctctattatcatgtgttcaggcggatttctaagcagctgccccagctcacc
tccctagagctgcagtatgtgtcccccaaacttctgatgtgccgggacctcgaactggcc
gtgcccggaacgtacgaccccaaccagccgatcattcgcattcagtccatagcgccgtcc
ctgcaggtcatcacctccaagcagaggccccggaagctgacgctcatgggcagcaacggg
catgagtttgttttcctcctgaagggccacgaagacctgcggcaggacgagcgagtgatg
cagctcttcggcctggtcaacacccttctggccaacgacccgacgtctcttcgcaagaac
ctcagcatccagagatacgccgtcatccccttatccaccaactcgggactcattggctgg
gtcccacactgcgacacgctgcacgccctcatccgggactacagagagaagaagaagatc
cttctcaacatcgagcatcgcatcatgttgcggatggctccagactacgatcacctgacg
ctgatgcagaaggtggaggtgttcgagcacgccgtcaacaacaccgccggcgacgacctg
gccaagctgctgtggctcaaaagccccagctccgaggtgtggtttgaccgaagaaccaac
tacacccgctcgttagctgtcatgtccatggtcgggtatattttgggcctgggagataga
cacccgtccaacctgatgctggaccggctgagcgggaagatcttgcacatcgacttcggg
gactgctttgaggttgctatgaccagggagaaattcccagagaagattccgtttagacta
acgagaatgctgaccaatgctatggaggtcaccggtctggatggcaactacaggatcacg
tgtcacacggtgatggaagtgcttcgggaacacaaggacagtgtcatggccgtgctggag
gcctttgtctatgaccccttgctcaactggaggctgatggacacaaataccaaaggcaac
aagcggtcccgaacgaggacggattcctactctgctggccagtcagtagaaattttggac
ggtgtggaacttggggagcccgcccataagaaaacggggaccacagtgccagaatctatc
cattctttcatcggagacggtttggtgaaacccgaggccctaaataagaaagctattcag
attataaacagggttcgagacaagctcactggtcgagacttttctcatgacgaaaccctg
gatgtcccaacacaggtggagctgctcatcaaacaagcaacgtcccacgaaaacctctgt
cagtgctacatcggctggtgtcctttctggtaa

DBGET integrated database retrieval system