KEGG   Enhydra lutris kenyoni (northern sea otter): 111154946
Entry
111154946         CDS       T05871                                 

Definition
(RefSeq) transferrin receptor protein 1 isoform X1
  KO
K06503  transferrin receptor
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04066  HIF-1 signaling pathway
elk04144  Endocytosis
elk04145  Phagosome
elk04216  Ferroptosis
elk04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    111154946
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111154946
   04145 Phagosome
    111154946
  09143 Cell growth and death
   04216 Ferroptosis
    111154946
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111154946
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:elk01002]
    111154946
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:elk04147]
    111154946
   04090 CD molecules [BR:elk04090]
    111154946
Peptidases and inhibitors [BR:elk01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   111154946
Exosome [BR:elk04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111154946
  Exosomal proteins of colorectal cancer cells
   111154946
CD molecules [BR:elk04090]
 Proteins
  111154946
SSDB
Motif
Pfam: Peptidase_M28 TFR_dimer PA
Other DBs
NCBI-GeneID: 111154946
NCBI-ProteinID: XP_022370619
UniProt: A0A2Y9KGM1
LinkDB
Position
Unknown
AA seq 770 aa
MMDQARSAFSTLFGGEPLSYTRFSLARQVDGDNSHVEMKLAADEEENVENNVRGNHASVT
KPKRLNGFICYGTIAVVLFFLIGFMIGYLGYCKRVEPKAECERPSGTESLETEGTEPSET
EEYFPETPSRLFWADLKKKLLERLHNTEFLTTMRLLNENTYVPREAGSQKDESLAFFIEN
QFRAFLLSKIWRDEHFVKIQVKSSSAQNSVTIVDTDSGVVYPVESPEGYVAYSKAATLTG
RLVHANFGTKKDFENLNSHVNGSLVIVRAGKITFAEKVANAQRFSAIGVLIYMDQTRFPI
INAKTPVFGHAHLGTGDPYTPGFPSFNHTQFPPSQSSGLPSIPVQTISRAAAEKLFENME
GDCPSAWETDSSCRLETSQNRNVKLTVNNVLKEIRIFNVFGVIKGFEEPDRYVVIGAQRD
AWGPGAAKSSVGTTLLLELAQIFSDMVLKDGFRPSRSIVFASWSAGDFGAIGATEWLEGY
LSSLHLKAFTYINLDKAVLGTNSFKVSASPLLYSLIEKTMKDVKHPVTGQSLYRDSNWFN
KVEEFSLDNAAFPFLAYSGIPAVSFCFCEDTYYPYLGTTMDVYEELEKKIPRLSEMARGA
AEFAAQLIMKLTYDLELNLNYEMYNDKILSFVRDMNRFRTDIKEMGLNLQWLYSARGDFF
RATSRLTTDYKNAERTNRYVMREINDRIMKVEYHFLSPYVSPRDSPFRHIFWGSGSHTLS
ALLEHLKLRQKNNSAFNETLLRNQLALATWTIQGAANALSGDIWDIDNEL
NT seq 2313 nt   +upstreamnt  +downstreamnt
atgatggatcaagccagatcagcattctctactttgtttggtggagaaccattgtcctat
acccggtttagtctggcacggcaagtagatggtgataacagtcatgtggagatgaaacta
gctgcagatgaagaagaaaatgttgaaaataacgtgaggggtaatcatgccagtgtcaca
aaaccaaaaaggttgaatggatttatctgctatgggactattgctgtagtcctctttttc
ttgattggatttatgattggctacttgggctattgtaagcgtgtggaaccaaaagctgaa
tgtgagagaccatcaggaacggagtctctggagacagagggaacagaaccttcagaaaca
gaagagtacttccctgaaacaccttctcgcttattttgggcagacctcaaaaaaaagttg
ttagagagactgcacaacacagagttcctcaccaccatgaggctgctgaatgaaaacacc
tatgtccctcgtgaggcgggatctcaaaaagatgaaagccttgcttttttcattgagaat
caattccgtgcatttctacttagcaaaatttggcgtgatgaacattttgttaagattcag
gtcaaaagcagcagtgctcagaactcggtgaccatagtggacacggacagtggtgtggta
tacccggtagagagtcctgagggttacgtggcatacagtaaggcagcgacccttacaggt
agactggtccatgctaattttggcacaaaaaaagactttgaaaatttaaactctcatgtg
aatggatctttagtgattgttagagcagggaaaatcacttttgctgaaaaggttgcaaat
gctcaaagattcagtgcaattggggtcttgatatacatggaccagactagatttcccatt
attaatgcaaagactccagtatttggccatgctcacttgggaacaggtgacccgtacaca
cctggattcccttctttcaatcacactcagtttccaccatcccagtcatcaggattgccc
agcattcctgtccaaacaatttccagagctgctgcagaaaagttgtttgaaaatatggaa
ggagactgtccttctgcctgggaaacagactcctcgtgcaggctggagacttcccagaac
aggaacgtgaagctcactgtgaataatgtgctgaaagagataagaatttttaacgttttt
ggagttattaaaggttttgaagaacctgatcgctatgttgtaataggggctcagagggat
gcctggggtcctggagctgcgaagtctagtgtgggaacaactctcctattggagcttgcc
cagatattttctgatatggtcttaaaagatggctttagacccagcagaagcattgtcttt
gccagctggagtgctggagactttggagcaattggtgccactgaatggctagagggatac
ctttcctccttgcatttaaaggctttcacctacattaatctagataaagctgttcttggt
accaacagcttcaaggtttctgccagcccactgttgtattcgcttattgagaaaacgatg
aaagatgtaaaacatccagttactgggcagtctctttatcgggacagcaactggttcaac
aaagtcgaggaattttctttggataatgctgctttccctttccttgcatattctggaatc
ccagcagtttctttctgtttttgtgaggacacatattatccttatttgggtactaccatg
gatgtctatgaggaactggaaaagaaaattcctcggttgagcgaaatggcacgtggagca
gcagaattcgctgctcagctcataatgaaacttacctatgatcttgaattgaacctgaac
tatgagatgtataatgacaaaatactttcatttgtgagggatatgaaccgattcagaaca
gacataaaggagatgggtctgaacctacagtggctgtattctgctcgtggggacttcttc
cgcgccacctccagactaacaacagattataagaacgcggagagaacgaacagatatgtt
atgagggagatcaatgaccgtatcatgaaagtggaatatcacttcctctcaccctatgta
tctccaagagattctcctttccggcatatcttctggggctctggctctcacactctgtca
gctttactagagcatttgaagctgcgtcagaaaaataacagtgcttttaatgaaacactg
ttgagaaaccagttggctctagcaacttggactattcaaggagctgcaaatgctctctct
ggtgacatatgggacattgacaatgagctttaa

DBGET integrated database retrieval system