KEGG   Enhydra lutris kenyoni (northern sea otter): 111155042
Entry
111155042         CDS       T05871                                 

Definition
(RefSeq) disks large homolog 1 isoform X1
  KO
K12076  disks large protein 1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04390  Hippo signaling pathway
elk04530  Tight junction
elk04660  T cell receptor signaling pathway
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    111155042
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    111155042
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    111155042
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111155042
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111155042
   05165 Human papillomavirus infection
    111155042
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:elk03036]
    111155042
Chromosome and associated proteins [BR:elk03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    111155042
SSDB
Motif
Pfam: Guanylate_kin PDZ MAGUK_N_PEST L27_1 PDZ_6 PDZ_assoc PDZ_2 SH3_1 SH3_2 SH3_9
Other DBs
NCBI-GeneID: 111155042
NCBI-ProteinID: XP_022370772
UniProt: A0A2Y9KAM3
LinkDB
Position
Unknown
AA seq 927 aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTL
LDNPKCVDRSKQSEPIQPVNTWEISSLPSTTVTSETLPSSLSPSVEKYRYQDEDTPPQEH
ISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKPTEAVPPSSPTVPVIPVLP
VPAENTVILPTIPQANPPPVLVNTESLETSTYVNGTDADYEYEEITLERGNSGLGFSIAG
GTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVHDVTHSKAVEALKEAG
SIVRLYVKRRKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAH
KDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYVPPDIT
NPASQPVDNHVSPSSYLGHTPASPARYSPVSKAMLGDDEITREPRKVVLHRGSTGLGFNI
VGGEDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRTASHEQAAAALKNAGQAVT
IVAQYRPEEYSRFEAKIHDLREQMMNSSISSGSGSLRTSQKRSLYVRALFDYDKTKDSGL
PSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKTVKF
NSKTRGDKGQSFNDKRKKNLFSRKFPFYKNKDQSEQETSDADQHITSNASDSESSYRGQE
EYVLSYEPVNQQEVNYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDG
RDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKR
LQIAQLYPISIFIKPKSMENIMEMNKRLTEEQARKTFERAMKLEQEFTEHFTAIVQGDTL
EDIYNQVKQIIEEQSGPYIWVPAKEKL
NT seq 2784 nt   +upstreamnt  +downstreamnt
atgccagtccggaagcaagacacccagagagctttgcaccttttggaagaatatcgttca
aaactaagccaaactgaagacagacagctcagaagttccatagaacgggttattaacata
tttcagagcaacctctttcaggctttaatagatattcaagaattttatgaagtgacctta
ctggataatccaaaatgtgtagatcgttcaaagcaatctgaaccaatacagcctgtgaat
acttgggaaatttccagccttccaagcactactgtgacttcagaaacactgccaagcagc
cttagccctagtgtagagaaataccggtatcaggatgaagacacacctcctcaagagcac
atttccccacaaatcactaatgaggtgataggtccggaactagttcatgtctcagagaag
aacctgtcagaaattgagaatgtccatggatttgtttcccattctcacatttcaccaata
aagccaacagaagctgtacctccctcttctcccactgtccctgtgatccctgtcctgcca
gtccctgctgagaatactgtcatcctacccaccataccacaggcaaatcctcctccagta
ctggtcaacacagagagcttggaaacgtcaacttatgttaatggcactgatgcagattac
gaatatgaagaaatcacacttgaaaggggaaattcagggcttggtttcagcattgcagga
ggtacggacaacccacacattggagatgactcaagtattttcattaccaaaattattaca
gggggagcagctgcccaagatggaagattacgggtcaatgactgtatattgcgagtaaat
gaagtagatgttcatgatgtgacacatagcaaagcagttgaagcattgaaagaagccggg
tctatcgtacgcttgtatgtaaaaagacggaaaccggtatcagaaaaaataatggaaata
aagctcattaaaggtcctaaaggtcttgggttcagcattgctggaggtgttggaaatcaa
catatccctggggataatagcatctatgtaaccaaaataattgaaggaggtgcagcacat
aaagatggtaaacttcagattggagataaacttttagcagtgaatagtgtgtgtttagag
gaagttactcatgaagaagcagtaactgccttaaagaatacgtctgattttgtttatttg
aaagtggcaaaacccacaagtatgtatatgaatgatggctatgtaccacctgatatcacc
aaccctgcttctcaacctgttgataaccatgttagcccatcttcctacttgggccataca
ccagcatcaccagccagatactcacctgtttcaaaagcaatgcttggagatgatgaaatt
acaagggaacctagaaaagttgttcttcatcgtggctcaacaggccttggtttcaacatt
gtaggaggtgaagatggagaaggaatatttatttcctttattttggctggaggacctgct
gatcttagtggagagctcagaaaaggagatcgtattatatcggtaaacagtgttgacctc
agaactgccagccatgagcaagcagcagctgctttgaaaaatgctggccaggctgtcacg
attgttgcacaatatcggcctgaagaatacagtcgttttgaagccaaaatacatgactta
cgggagcagatgatgaatagtagcattagttcaggatcaggttctcttcgaactagccag
aagcgatccctctatgtcagagctctttttgattatgacaagactaaagacagtggcctt
cccagtcagggattgaacttcaaatttggagatatcctccatgttattaatgcttctgat
gacgaatggtggcaagccaggcaggtcacaccagatggggagagtgacgaagttggggta
attcccagtaaacgcagagttgagaagaaagaacgagcccggttaaaaacagtgaaattt
aattctaaaacaagaggagataaagggcagtcattcaatgacaagcgtaaaaagaacctc
ttttcccgaaaattccccttctacaagaacaaggaccagagtgaacaggaaacaagtgat
gctgaccagcatataacttctaatgccagcgatagtgaaagtagttaccgtggtcaagag
gaatatgtcttatcttatgagccagtgaatcaacaagaagttaattatactcgaccagtg
atcatattgggacctatgaaagacaggataaatgatgacttgatctcagaatttcctgac
aaatttggatcatgtgttcctcatacaactagaccaaaacgagactacgaggtagatgga
agagattatcattttgtgacttcaagagagcagatggaaaaagatattcaagaacataaa
tttattgaagctggccagtataacaaccatctgtatggaacaagtgttcagtctgtgcgg
gaagtagcagaaaagggcaaacactgtatcctcgatgtgtctggaaatgccataaagaga
ttacagattgcacaactttacccaatctccatttttattaaacccaaatccatggaaaat
atcatggaaatgaataagcgtctaacagaagaacaagccagaaagacatttgaaagagcc
atgaaactggaacaagaatttactgaacattttacagctattgtacagggagatacgctg
gaagacatttataaccaagtgaagcagatcatagaggaacagtctggtccgtacatctgg
gttccagcaaaagaaaagttatga

DBGET integrated database retrieval system