KEGG   Enhydra lutris kenyoni (northern sea otter): 111155331Help
Entry
111155331         CDS       T05871                                 

Definition
(RefSeq) N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D
  KO
K13985  N-acyl-phosphatidylethanolamine-hydrolysing phospholipase D [EC:3.1.4.54]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04723  Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:elk00001]
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    111155331
Enzymes [BR:elk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.54  N-acetylphosphatidylethanolamine-hydrolysing phospholipase D
     111155331
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lactamase_B_2 Lactamase_B_3 Lactamase_B
Motif
Other DBs
NCBI-GeneID: 111155331
NCBI-ProteinID: XP_022371186
UniProt: A0A2Y9KDH4
LinkDB All DBs
Position
Unknown
AA seq 394 aa AA seqDB search
MDENESSQSLMTSSQYPKEAVRKRQNSTRSSVGSDSSRFSRKSFKLDYRLEEDVTKSKKG
KDGRFVNPWPTWKNLSIPNVLRWLIMEKDHSSVPGSKEELDKELPVLKPYFIDEPEEAGV
REAGLRVTWLGHATVMVEMDELIFLTDPIFSSRASPSQHVGPKRFRRAPCTVSELPPIDA
VLISHNHYDHLDYNSVLALNERFGSELRWFVPLGLLDWMQKCGCENVIELDWWEENCVPG
HDQVTFVFTPSQHWCKRTLMDDNKVLWGSWSVLGPWSRFFFAGDTGYCPAFEEIGKRFGP
FDLAAIPIGAYEPRWFMKYQHVDPEEAVRIHIDVQTRKSVAIHWGTFALANEHYLEPPVK
LSEALGRYGLKPEDFFVLKHGESRYLNTDEDNSE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaaatgaaagcagccagtccctgatgacgagcagccaatatccaaaagaagca
gtaagaaaacgccaaaattcaacccggagctctgtaggaagtgattcttctaggttttcc
aggaaaagtttcaaactggattacagactagaggaagatgtaactaaatcaaagaaagga
aaggatggcagatttgttaacccatggccgacgtggaaaaatctctccattccaaacgtt
ctcagatggctgataatggaaaaagatcacagcagtgttccaggctccaaggaggaactt
gacaaagagctcccggtgctgaagccgtattttatcgacgagccggaggaggctggagtg
cgggaggccggcctgcgggtcacgtggctgggacacgccacggtgatggtggaaatggac
gagctcatcttcctcaccgaccccatcttcagctctcgcgcgtcaccgtcacagcacgtg
ggtcccaagcggttccgccgcgcaccctgcaccgtgagcgaactgcccccgatagacgcg
gtcctcatcagccacaaccactatgaccacctggactacaactccgtcctcgccctgaac
gagcgcttcggctcggagctgcggtggttcgtgcctctgggcctcctcgactggatgcag
aagtgcggctgcgagaacgtgatcgagctggactggtgggaggagaactgtgtccccggc
cacgatcaggtcacctttgtcttcaccccttcacagcactggtgtaaaaggactctcatg
gatgacaacaaggttctgtggggcagctggtctgtcttggggccctggagccggtttttt
ttcgcaggagacactggttattgcccggctttcgaagagataggaaaacggtttggcccc
ttcgacctcgcggctattcccatcggcgcgtatgaacccaggtggtttatgaaataccag
cacgtagacccagaagaagctgtgaggattcacattgacgttcagacaaggaaatctgtg
gcaattcactggggaacttttgccttagcaaatgagcattacttggagcccccagtgaag
ctgagcgaggctctaggaagatacggacttaagccggaagatttttttgtcttgaagcat
ggagaatccagatacctcaatactgatgaggacaactcggaataa

DBGET integrated database retrieval system