KEGG   Enhydra lutris kenyoni (northern sea otter): 111155370
Entry
111155370         CDS       T05871                                 

Definition
(RefSeq) tyrosine-protein kinase Lyn isoform X1
  KO
K05854  tyrosine-protein kinase Lyn [EC:2.7.10.2]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04062  Chemokine signaling pathway
elk04064  NF-kappa B signaling pathway
elk04611  Platelet activation
elk04662  B cell receptor signaling pathway
elk04664  Fc epsilon RI signaling pathway
elk04666  Fc gamma R-mediated phagocytosis
elk04730  Long-term depression
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05169  Epstein-Barr virus infection
elk05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    111155370
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111155370
   04662 B cell receptor signaling pathway
    111155370
   04664 Fc epsilon RI signaling pathway
    111155370
   04666 Fc gamma R-mediated phagocytosis
    111155370
   04062 Chemokine signaling pathway
    111155370
  09156 Nervous system
   04730 Long-term depression
    111155370
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111155370
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    111155370
   05169 Epstein-Barr virus infection
    111155370
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111155370
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:elk04131]
    111155370
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     111155370
Protein kinases [BR:elk01001]
 Non-receptor tyrosine kinases
  SRC family
   111155370
Membrane trafficking [BR:elk04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    111155370
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_3
Other DBs
NCBI-GeneID: 111155370
NCBI-ProteinID: XP_022371222
UniProt: A0A2Y9KDK4
LinkDB
Position
Unknown
AA seq 512 aa
MGCIKSKRKDNLNDDGIDLKTQPVRNTDRTIYVRDPTSNKQQRPVPESQLLPGQRFQTKD
PEEQGDIVIALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLSTKREGFIPSNYVAK
VNTLETEEWFFKDITRKDAERQLLAPGNGPGAFLIRESETLKGSYSLSVRDYDPVHGDVI
KHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQSDGLCRRLEKACISPKPQKPWDKDAW
EIPRDSIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHD
KLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIER
KNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCF
TIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRMENCPDELYDIMKMCW
KEKAEERPTFDYLQSVLDDFYTATEGQYQQQP
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgggatgtataaaatcaaaaaggaaagacaatctgaatgacgatggaatagatttgaag
actcaaccagtacgtaatactgaccgaactatttatgtgagagatccaacgtccaataaa
cagcaaaggccagttccagaatctcagcttttaccaggacagaggtttcagactaaagat
ccggaggagcaaggagacatcgtgatagccttgtacccctatgatggcatccacccagac
gacttgtctttcaagaaaggagaaaagatgaaggtcctggaggagcatggagaatggtgg
aaagctaaatccctttcaacgaagagagaagggttcatccccagcaactacgtcgccaaa
gtcaacaccctggaaacagaagagtggtttttcaaggacataaccaggaaggatgcagaa
aggcagctgctggcaccagggaacggtcctggagcttttcttatcagagaaagtgaaacc
ttaaaaggaagctactctctttctgtcagagattatgaccctgtgcatggtgatgttatt
aagcactacaaaattagaagtctggacaatggagggtattacatttctccacgaatcact
ttcccttgtatcagtgacatgattaaacattaccaaaagcagtcggatggcttatgcaga
agattggaaaaggcatgcattagccccaaaccacaaaagccatgggacaaagatgcctgg
gagatcccacgggattccatcaagttggtgaaaagacttggtgccgggcaattcggggaa
gtctggatgggttactataacaatagtaccaaagtggctgtgaaaaccctgaaaccgggc
actatgtctgtgcaagcattcctggaggaagccaacctcatgaaaacccttcagcacgac
aagctggtgaggctctatgccgtggttaccagagaagagcctatctacatcatcactgag
tacatggccaagggcagtttgctggatttcctgaagagtgacgaagggggcaaggtgctg
cttcccaagctaattgacttttctgcccagattgcagagggaatggcatacatcgagagg
aagaactacattcaccgagacctacgagcggctaacgttctggtctctgagtcactcatg
tgcaaaattgcagattttggccttgctcgagtaatcgaagacaatgagtacacagcaagg
gaaggtgccaaattccccattaagtggacagctccagaagccatcaactttggatgtttc
acgattaagtctgatgtgtggtccttcggaattctcctgtatgaaatcgtcacctatggg
aaaattccctacccagggagaactaatgccgatgtgatgaccgccctgtcccagggctac
aggatgccccgcatggagaactgcccagacgagctctatgacatcatgaaaatgtgctgg
aaggaaaaggcagaagagaggccaacattcgattacttgcagagcgtcctggatgatttc
tacactgccacggaagggcagtatcagcagcagccttaa

DBGET integrated database retrieval system