KEGG   Enhydra lutris kenyoni (northern sea otter): 111155673
Entry
111155673         CDS       T05871                                 

Definition
(RefSeq) transmembrane protease serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk05164  Influenza A
elk05171  Coronavirus disease - COVID-19
elk05202  Transcriptional misregulation in cancer
elk05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    111155673
  09162 Cancer: specific types
   05215 Prostate cancer
    111155673
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    111155673
   05164 Influenza A
    111155673
Enzymes [BR:elk01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     111155673
Peptidases and inhibitors [BR:elk01002]
 Serine peptidases
  Family S1: chymotrypsin family
   111155673
SSDB
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR DUF1986 SRCR Ldl_recept_a Trypsin_2
Other DBs
NCBI-GeneID: 111155673
NCBI-ProteinID: XP_022371671
UniProt: A0A2Y9KDU8
LinkDB
Position
Unknown
AA seq 558 aa
MALNSGSPPGVGPYYENHGYQPESLYPAQPTTVPGVYPVYPAPYYPPAVPQYTPGVLTHA
STPAVHTQPKSPSGTACTAKAKKALCITVSLGAVLAGAAVTAVLLWKFMENKCSVSGIEC
GSSGTCISPSHWCDGVLHCPSGEDENRCVRLYGPNFILQVYSAQRKSWHPVCQDDWSDSY
GRAACQDMGYRNSFYSSQGIVDDSGASSFMKLNTSAGNMDLYKKLYHSDICASKTVVSLR
CIECGVTGKTMRQSRIVGGSSASPGDWPWQVSLHVQGTHVCGGSIITPEWIVTAAHCVEE
PLNNPRYWTVFAGILRQSFMFYGHGYRVGKVISHPSYDSKTKNNDIALMKLQTPLTFNDK
VKPVCLPNPGMMLEPNQSCWISGWGATHEKGKTSDELNAVMVPLIEPWRCNSKYVYNSLV
TPAMICAGYLRGGTDSCQGDSGGPLVTLKSRLWWLIGDTSWGSGCAKANRPGVYGNVAVF
TDWIYRQMRDMSLENIRSHPPSDGSPVPSPDQTKENSRHCRAPQGQLKVKAFAASQPSAG
ETLPGAFCRFVKYSPQRV
NT seq 1677 nt   +upstreamnt  +downstreamnt
atggctttgaactcagggtcaccgccaggagttggaccttactatgaaaaccatggatac
cagcccgaaagcctgtatcccgcgcagcccaccacggtccccggtgtctacccggtgtat
ccagccccgtactacccgcctgccgtgccccagtacacccctggggtgctgacgcacgct
tcgacacccgccgtccacacgcagcccaagtccccatcggggacagcgtgtaccgcaaag
gccaagaaggcgctgtgcatcaccgtctccctgggggccgtcctggcgggagccgccgtg
accgcagttctgctctggaagttcatggagaacaaatgctcggtgtccgggatagagtgc
ggctcgtcgggaacctgcatcagcccctctcactggtgcgacggggtcctgcactgccct
agcggggaggacgagaaccgatgcgttcgcctctacggcccgaacttcatcctccaggtg
tactccgcccagaggaagtcctggcaccccgtgtgtcaggacgactggagcgatagctac
gggagggccgcctgccaggacatgggctaccggaatagtttttattctagccaagggatc
gtggatgacagcggagcctccagctttatgaagctgaacacaagtgcgggcaatatggac
ctgtacaagaagctgtaccacagtgacatctgcgcctcgaaaacagtggtttctttgcgt
tgtatagagtgcggggtcacggggaagacgatgcgccagagccgaattgtgggcgggagc
agcgcgtccccaggggactggccctggcaggtcagcctgcacgtgcagggcacccacgtc
tgcgggggctccatcatcacccccgagtggatcgtgacagctgcccactgtgtggaggaa
cccctgaacaacccccggtactggacggtcttcgcgggcatcctgagacagtctttcatg
ttctacggacacggataccgagtggggaaagtgatttcccatcccagttacgactccaag
accaagaacaatgacatcgctttaatgaagttgcagacgcctctgactttcaacgacaaa
gtgaaaccagtgtgtctgcccaacccgggcatgatgctggagccgaaccagtcctgctgg
atttccgggtggggggccacccacgagaaagggaagacctcggacgagctgaacgcggtc
atggtgcccctcatcgagccctggcgatgcaacagcaagtacgtctacaacagcctggtc
acgccggccatgatctgcgcgggctacctgcggggaggcaccgactcctgccagggtgac
agcggaggtcccctggtcactttgaagagccgcctctggtggctgatcggggacacgagc
tggggatcgggctgcgccaaagctaacaggccaggcgtgtacggaaacgtggcggtgttt
acggactggatttaccgacaaatgagggacatgtccctggagaacattcgctcccaccct
ccttcggacggctctcctgtccccagccctgaccagaccaaggagaacagtagacactgc
agggctccccaaggacaactcaaggtcaaggcctttgccgcctcccagccatctgcagga
gagaccctgccgggcgctttttgccggtttgtgaaatactcaccccagcgagtctag

DBGET integrated database retrieval system