KEGG   Enhydra lutris kenyoni (northern sea otter): 111155700
Entry
111155700         CDS       T05871                                 

Definition
(RefSeq) transcriptional regulator ERG isoform X1
  KO
K09435  transcriptional regulator ERG
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk05202  Transcriptional misregulation in cancer
elk05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    111155700
  09162 Cancer: specific types
   05215 Prostate cancer
    111155700
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111155700
Transcription factors [BR:elk03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    111155700
SSDB
Motif
Pfam: Ets SAM_PNT SAM_3 SAM_2 SAM_1
Other DBs
NCBI-GeneID: 111155700
NCBI-ProteinID: XP_022371719
UniProt: A0A2Y9KJV4
LinkDB
Position
Unknown
AA seq 486 aa
MVQTVPDPAAHIKEALSVVSEDQSLFECAYGTPHLAKTDMTASSSGDYGQTSKMSPRVPQ
QDWLSQPPARVTIKMECNPNQVNGSRNSPDECSMAKGGKMVGSPDTVGMNYGSYMEEKHM
PPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKEYGLPDVDILLFQNIDGKELCKMTK
DDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPN
TSVYPEATQRITTRPDLPYDPPRRSAWTSHGHPTPQSKAAQPSPSAVPKTEDQRPQLDPY
QILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGE
RKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPS
DLPYMGSYHAHPQKMNFVAPHPPALPVTSSSFFATPNPYWNSPTGGIYPNTRLPAGHMPS
HLGTYY
NT seq 1461 nt   +upstreamnt  +downstreamnt
atggttcagactgtcccagacccagcagctcatatcaaggaagcattatcggttgtgagc
gaggaccagtctttgtttgagtgtgcctacgggacgccacacctggctaagacggacatg
accgcatcctcttccggcgactatggacagacatccaagatgagcccacgtgtccctcag
caagactggctgtctcaacccccagccagggtcaccatcaagatggaatgtaaccctaac
caggtgaacggctcaaggaactccccggatgaatgcagcatggcaaaaggcgggaagatg
gtgggcagcccagacactgtgggcatgaattacggcagctacatggaggagaagcacatg
ccgcccccaaacatgactacgaacgagcgcagagtcatcgtcccagcagaccctacgctg
tggagtacggaccatgtccggcagtggctggagtgggcagtgaaagaatacggcctccca
gacgtcgatatcttgctgttccagaacattgatgggaaggaactgtgcaagatgaccaag
gacgacttccagaggctcaccccgagctacaacgctgacatccttctctcgcacctgcac
tacctcagagagactcctcttccacatttgacttcagatgatgttgataaagccttacaa
aactctccacggttaatgcatgctagaaacacagggggtgcagcttttatattcccaaat
acttcagtatatcctgaagccacgcaaagaattacaactaggccagatttaccttatgac
ccacccaggagatcagcctggactagtcacggccaccccaccccccagtcgaaagctgct
cagccgtctccttccgcagtgcccaaaactgaagatcagcgtcctcagctagatccttat
cagattcttggaccaacaagtagccgccttgcaaacccagggagtggacagatccagctt
tggcagtttctcctggagctcctgtcagacagctcaaactccaactgcatcacctgggaa
ggcaccaatggggaattcaagatgaccgatcctgatgaggttgcccggcgctggggagaa
cggaaaagcaaacccaatatgaactacgataaactcagccgtgccctccgctactactat
gacaaaaatatcatgaccaaagtccacgggaagcgctacgcctacaagtttgacttccat
gggatcgcccaggccctacagccccaccctccagaatcatctctgtacaagtacccctcg
gacctcccttacatgggctcctatcacgcccaccctcagaagatgaactttgtggccccc
caccctccggctctccctgtgacatcgtccagtttcttcgccaccccaaacccttactgg
aattcgccaaccggaggtatataccccaacacgaggcttccggccggccatatgccctca
catctgggcacttactactag

DBGET integrated database retrieval system