KEGG   Enhydra lutris kenyoni (northern sea otter): 111156118
Entry
111156118         CDS       T05871                                 

Definition
(RefSeq) axin-1 isoform X1
  KO
K02157  axin 1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04310  Wnt signaling pathway
elk04390  Hippo signaling pathway
elk04550  Signaling pathways regulating pluripotency of stem cells
elk04934  Cushing syndrome
elk05010  Alzheimer disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05165  Human papillomavirus infection
elk05200  Pathways in cancer
elk05210  Colorectal cancer
elk05213  Endometrial cancer
elk05217  Basal cell carcinoma
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111156118
   04390 Hippo signaling pathway
    111156118
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111156118
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111156118
  09162 Cancer: specific types
   05210 Colorectal cancer
    111156118
   05225 Hepatocellular carcinoma
    111156118
   05226 Gastric cancer
    111156118
   05217 Basal cell carcinoma
    111156118
   05213 Endometrial cancer
    111156118
   05224 Breast cancer
    111156118
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111156118
   05022 Pathways of neurodegeneration - multiple diseases
    111156118
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111156118
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111156118
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:elk01009]
    111156118
Protein phosphatases and associated proteins [BR:elk01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111156118
SSDB
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind Rootletin
Other DBs
NCBI-GeneID: 111156118
NCBI-ProteinID: XP_022372455
UniProt: A0A2Y9KTH2
LinkDB
Position
Unknown
AA seq 826 aa
MNIQEQGFPLDLGTSFTEDAPRPPVPGEEGELVSTDPRPVSYSFCSGKGETSAATPRRSD
LDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGINLFRTFLKQEDCADLLDFWFACSGFR
KLEPCDSNEEKRLKLAKAIYRKYILDNTGIVSRQTKPATKSFIKDCIMKQLVDPAMFDQA
QTEIQSTMEENTYPSFLKSDIYLEYTRTGSESPKLCSDQSSGSGTGKGVPGYLPTLNEDE
EWKCDQDPDEDSGRDPAPPGRLTQKLLLETAAPRASSSRRYSEGREFRCGSWREPVNPYY
VSSGYALAPATSANDSEQQSLSSDADSLSLTDSSVDGVPPYRIRRQHRREMQESVQVNGR
VPLPHIPRTYRMPKEIRVEPQKFAAELIHRLEAVQRTREAEEKLEERLKRVRMEEEGEDG
DMPSGPLGASHKLPLAPAWHHFPPRYADVGCIGLRDAHEENPESILDEHVQRVMRTPGCQ
SPGPGHRSPDSTHVPKIVGVLGGMPSGHGKHAPKSGAKLDTAGPHLHRHGHHHSHHSTAR
PKEQADAEAARRAQGSFPWGQEVHSHAAKPRSHLESVGTAPNASDSLAYSGKAGAAPRRS
AKKAELGRSAGAEAPGPSEDTEKNQKIMQWIIEGEKEISRHRKAGHGSSGTKKQQAHESS
RPLSVERPGAVHPWVSAQLRNSVQPSHLFVQDPTMPPNPAPNPLTQLEEARRRLEEEEKR
ASKLPSKQRTKSQRKAGSGSVQPCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTK
KGNYRYYFKKVSDEFDCGVVFEEVREDDMVLPVFEEKIIGKVEKVD
NT seq 2481 nt   +upstreamnt  +downstreamnt
atgaatatccaagaacagggtttccctttggaccttggaacaagtttcaccgaagatgcc
ccccgacccccagtgcctggtgaggagggtgaactggtgtccacagaccccaggcccgtc
agctacagcttctgctccgggaagggggagacttcagccgccaccccgaggcgctcggat
ctggacctggggtacgagcctgagggcagcgcctcacccaccccgccatacttgaagtgg
gccgagtcactgcactccctactggacgatcaagacgggataaacctgtttcggactttc
ctgaagcaggaggactgtgcggacctgctggacttctggttcgcctgcagcggcttcagg
aagctggagccctgtgactcgaacgaggagaagaggctgaagctggccaaagcgatctac
cgcaagtacatcctcgacaacaccggcatcgtgtcccggcagacaaagcccgcgaccaag
agcttcataaaagactgcatcatgaagcagctggtcgaccctgccatgtttgaccaggcc
cagacggagatccagtccaccatggaagagaacacctacccctctttcctcaagtccgat
atttatttggaatatacgaggaccggctcggagagcccgaagctctgtagtgaccagagc
tctgggtccgggacggggaagggcgtacccggatacctgcccactctgaacgaagacgag
gaatggaagtgtgaccaggacccagacgaagacagtggcagagaccctgctccccccggc
aggctcacacagaagctgcttctggagacggccgccccgcgggcctcctcaagtagacgg
tacagcgaaggcagagaattcaggtgcgggtcctggcgggagcctgtcaatccttactac
gtcagctccggctatgctctcgccccggccaccagcgccaacgacagcgagcagcagagc
ctgtccagcgatgcggacagcctgtccctcaccgacagcagcgtggatggcgtcccgccg
tacaggatccgcaggcagcaccgccgggagatgcaggagagtgtccaggtcaacgggcgg
gtgcctctacctcacatcccccgcacttaccgaatgccaaaggaaatccgtgtggagccc
cagaagttcgccgcggagctcatccaccgcctggaggccgtgcagcggacacgggaggcc
gaggagaagctggaggagcggctgaagcgcgtccggatggaggaagaaggcgaggatggg
gacatgccgtctggccccctgggggccagtcataagctgcctttggcccccgcctggcac
cacttcccgccccgctacgcagatgtgggctgcatagggctccgggacgcgcacgaggag
aacccggagagcatcctggacgagcacgtgcagcgggtcatgaggacacctggctgccag
tcaccggggcctggccaccgctcccctgacagcacgcatgtgcccaagatcgtgggtgtg
ctggggggcatgccctctgggcacgggaagcacgcgcccaagtcaggggcgaagctggac
acggctggcccgcacctgcaccggcacggccaccaccacagccaccacagcacggccagg
cccaaggagcaggccgacgctgaggctgcccgccgggcacagggcagcttcccgtggggc
caagaggtgcacagccacgcggccaagcctcgcagccacttggagagcgtgggcaccgcc
cccaatgccagcgacagcctggcctacagcgggaaggccggcgctgcccccagaagaagt
gccaagaaggctgagttggggaggagcgcgggcgcggaggcgccaggcccgtcggaggac
acggagaagaaccagaagattatgcagtggatcatcgagggggagaaggagatcagccgg
caccgcaaggccggccacgggtcttccggcaccaagaagcagcaggcacacgagagctct
aggcccttgtctgtggagcgtcctggggctgtgcatccttgggtcagcgctcagctgcgg
aactccgtccagccctctcacctcttcgttcaagaccccaccatgccacccaaccctgcc
cccaaccctctgacccagctggaggaggcccgcaggcgtctggaggaggaagagaagaga
gccagcaagttaccctccaagcagaggacgaagtcccagagaaaggcgggcagtgggagt
gtgcagccgtgtgacagcatcgtggtggcctactacttctgcggggagcccatcccctac
aggaccctggtgcggggccgtgccgtcaccctgggccagttcaaggagctgctcaccaag
aaaggcaactacagatactacttcaagaaagtgagcgatgagtttgactgtggtgtggtg
tttgaggaggttcgggaagacgacatggtgctgcccgtgtttgaggagaagatcatcggc
aaggtggagaaggtagactga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111158088
Entry
111158088         CDS       T05871                                 

Definition
(RefSeq) axin-2 isoform X1
  KO
K04385  axin 2
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04310  Wnt signaling pathway
elk04390  Hippo signaling pathway
elk04550  Signaling pathways regulating pluripotency of stem cells
elk04934  Cushing syndrome
elk05010  Alzheimer disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05165  Human papillomavirus infection
elk05200  Pathways in cancer
elk05210  Colorectal cancer
elk05213  Endometrial cancer
elk05217  Basal cell carcinoma
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111158088
   04390 Hippo signaling pathway
    111158088
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    111158088
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111158088
  09162 Cancer: specific types
   05210 Colorectal cancer
    111158088
   05225 Hepatocellular carcinoma
    111158088
   05226 Gastric cancer
    111158088
   05217 Basal cell carcinoma
    111158088
   05213 Endometrial cancer
    111158088
   05224 Breast cancer
    111158088
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111158088
   05022 Pathways of neurodegeneration - multiple diseases
    111158088
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111158088
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111158088
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:elk03036]
    111158088
Chromosome and associated proteins [BR:elk03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    111158088
SSDB
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind
Other DBs
NCBI-GeneID: 111158088
NCBI-ProteinID: XP_022375628
UniProt: A0A2Y9KR71
LinkDB
Position
Unknown
AA seq 843 aa
MSSAVLVTRLPDPSSSFHEDAPRPPVPGEEGETPPCQPGVGKGQVTKPMPVSSNARRNED
GLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLERDKCVDTLDFWFACNGFRQM
NLKDTKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQIDSIMFDQAQTEIQS
VMEENAYQMFLTSDIYLEYVRSGGENTAYMSNGGLGSLKVVCGYLPTLNEEEEWACADFK
CKLSPTVVGLSSKTLRATANVRSTEVVENGYRSFKRSDPVNPYHVGSGYVFAPATSANDS
EISSDALTDDSMSMTDSSVDGIPPYRVGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPK
EMTPVEPATFAAELISRLEKLKLELESRHSLEERLQQIREDEEKEASELALSSRDGGPAP
HPLSLLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHHHQPYHPLL
PPGGKLPPVATSQATCPLLAAKSFVTKQTTKHVHHHYIHHHALPKSKEEIEAEAAQRVRC
FCPGGAEYYCYSKCRSHPKALEPAQAEQFGSSSRGSTLPKRSGRSVEPGLTPPAREGGAP
GGAGAAQLPGEEGDRSQDVWQWMLESERQSKPKAPSAQSTKKAYPLESARAPLAERAGRH
HLLGGSNGHPRATPRAHPFTQDPAMPPLTPPNTLAQLEEACRRLAEVSKPPKQRCCAAGQ
QRDRNHSTAGQAGAPPFSSPSLACEDHKEPKKLTGVHALQASELVVTYFFCGEEIPYRRM
LKAQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWDDEAVLPMYEGRILGKVE
RID
NT seq 2532 nt   +upstreamnt  +downstreamnt
atgagcagtgctgtgctggtgactcgcctcccagaccccagcagcagcttccacgaggat
gccccccggccccctgtccccggggaagaaggggagaccccgccgtgccagcccggggta
ggaaagggccaggtcaccaaacccatgcctgtctcctccaacgccaggcggaatgaggat
gggttgggggagcccgagggacgggcatccccggattcccctctgaccaggtggaccaag
tccttgcactccttgctgggcgatcaagatggtgcttatctcttccgcactttcctggag
agggacaaatgcgtggataccttagacttctggtttgcctgcaatggcttcaggcagatg
aacctgaaggataccaaaactttacgagtagccaaagcgatctacaagaggtacattgag
aacaacagcatcgtctccaagcagctgaaaccggccaccaaaacctacataagagatggc
atcaagaagcaacagattgattccatcatgtttgaccaggcgcagaccgagatccagtcg
gtgatggaggaaaatgcctaccagatgtttttgacttctgatatatacctcgaatatgtg
aggagtgggggagaaaacacggcttacatgagtaacgggggactggggagcctcaaggtc
gtgtgtggctatctccccaccttgaacgaggaagaggagtgggcctgtgctgacttcaag
tgcaaactgtcacccactgtggttggcttgtccagcaaaaccctgagggccacagcgaac
gtgcggtccaccgaggttgttgagaatggatacaggtccttcaagaggagcgatcccgtt
aatccataccatgtaggctctggctatgtctttgcgccggctaccagcgccaacgatagt
gagatatcgagcgacgcactgacggatgactccatgtccatgacggacagcagcgtagat
ggaatccctccttaccgtgtggggagtaagaaacagctccagagagaaatgcatcgcagt
gtgaaggccaatggccaagtgtctctacctcatttcccgagaacccatcgcctgcccaag
gagatgacccccgtggagcccgccaccttcgcggcggagctcatctccaggctggagaag
ctgaagctggagctggagagccgccacagcctggaggagcgtctgcagcagatccgagag
gatgaagagaaggaggcctccgagcttgcgctgagctccagggacggggggcccgccccg
caccctctctccctcctgccctccggcagctacgaggaggacccgcagaccattctggac
gaccatctgtccagggtcctcaagacccccggctgccagtccccgggcgtgggccgctat
agccctcgctcccgctcccccgaccaccaccaccaccatcagccgtaccaccccctgctc
ccgcccgggggcaagttgccccccgtggccacctcgcaggccacttgccccctcctcgca
gccaagagcttcgtgaccaagcagaccaccaagcatgtccaccaccactacatccaccac
cacgccctccccaagagcaaggaggagatcgaggcggaggctgcccagagggtgcgctgc
ttctgccccgggggcgcggagtattactgctactccaagtgcaggagtcacccgaaggca
ctggagcccgcgcaggcggagcagtttggcagcagcagccgaggcagtaccctgcccaag
cgcagcgggagaagcgtggagccgggcctgaccccgcccgccagggaaggaggggcgccc
ggcggagctggggccgcgcagcttccaggggaggaaggagacaggtcgcaggatgtctgg
caatggatgctggagagtgagcggcagagcaaacccaaggcccctagtgcccaaagcaca
aagaaggcttacccgctggagtccgcccgtgcgcccctagccgagcgagcgggccggcac
cacctgctgggaggcagcaacgggcacccccgcgccaccccccgagcccacccgttcacc
caggaccccgcgatgcctcccctgaccccgcccaacacgctggctcagctggaggaggcc
tgccgccggctggctgaggtgtccaagccccccaaacagcggtgctgtgcagccggtcag
cagagggacaggaatcactccaccgcgggtcaggcgggagccccgcccttctccagcccc
agcctggcttgcgaagatcacaaagagccaaagaagctgacgggggttcacgcactccag
gccagcgagttggtcgttacatactttttctgtggagaagaaattccgtacaggaggatg
ctgaaggctcagagcctgaccctgggccactttaaagagcagctcagcaaaaagggaaat
tataggtattacttcaaaaaagcaagcgacgagtttgcctgcggagccgtgtttgaggag
atctgggacgatgaggcagtactccccatgtacgaaggcaggatcctggggaaggtggag
aggatcgactga

DBGET integrated database retrieval system