KEGG   Enhydra lutris kenyoni (northern sea otter): 111156131
Entry
111156131         CDS       T05871                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: CREB-binding protein
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04024  cAMP signaling pathway
elk04066  HIF-1 signaling pathway
elk04068  FoxO signaling pathway
elk04110  Cell cycle
elk04310  Wnt signaling pathway
elk04330  Notch signaling pathway
elk04350  TGF-beta signaling pathway
elk04520  Adherens junction
elk04630  JAK-STAT signaling pathway
elk04720  Long-term potentiation
elk04916  Melanogenesis
elk04919  Thyroid hormone signaling pathway
elk04922  Glucagon signaling pathway
elk04935  Growth hormone synthesis, secretion and action
elk05016  Huntington disease
elk05152  Tuberculosis
elk05161  Hepatitis B
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05200  Pathways in cancer
elk05203  Viral carcinogenesis
elk05206  MicroRNAs in cancer
elk05211  Renal cell carcinoma
elk05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111156131
   04330 Notch signaling pathway
    111156131
   04350 TGF-beta signaling pathway
    111156131
   04630 JAK-STAT signaling pathway
    111156131
   04066 HIF-1 signaling pathway
    111156131
   04068 FoxO signaling pathway
    111156131
   04024 cAMP signaling pathway
    111156131
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111156131
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111156131
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    111156131
   04935 Growth hormone synthesis, secretion and action
    111156131
   04919 Thyroid hormone signaling pathway
    111156131
   04916 Melanogenesis
    111156131
  09156 Nervous system
   04720 Long-term potentiation
    111156131
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111156131
   05206 MicroRNAs in cancer
    111156131
   05203 Viral carcinogenesis
    111156131
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    111156131
   05215 Prostate cancer
    111156131
  09164 Neurodegenerative disease
   05016 Huntington disease
    111156131
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111156131
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111156131
   05161 Hepatitis B
    111156131
   05164 Influenza A
    111156131
   05167 Kaposi sarcoma-associated herpesvirus infection
    111156131
   05165 Human papillomavirus infection
    111156131
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111156131
   03036 Chromosome and associated proteins [BR:elk03036]
    111156131
   03029 Mitochondrial biogenesis [BR:elk03029]
    111156131
Enzymes [BR:elk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     111156131
Transcription factors [BR:elk03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    111156131
Chromosome and associated proteins [BR:elk03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    111156131
Mitochondrial biogenesis [BR:elk03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    111156131
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 111156131
NCBI-ProteinID: XP_022372483
UniProt: A0A2Y9KH82
LinkDB
Position
Unknown
AA seq 2442 aa
MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGGELSLLNSGNLV
PDAASKHKQLSELLRGGGGSSMNPGIGNVSASSPAQQGLGGQAQGQPNSANMASLGAMGK
SPLNQGDSAAPSLPKQAASTSGPTPPASQALNPQAQKQVGLVTSSPATSQTGPGICMNAN
FNQTHPGLLNSNSGHSLMNQAQQGQAQVMNGSLGAAGRGRGAGMPYPAPAMQGAASSVLA
ETLTQVSPQMASHAGLNTAQAGGMTKVGMTGNTSPFGQPFSQTGGQQMGAPGVNPQLSSK
QSMVNSLPPFPTDIKNASVTNVPNMSQMQTSVGIVPTQAIAAGPTADPEKRKLIQQQLVL
LLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWK
NCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNAASLSNPNPIDPSS
MQRAYAALGLPYLNQPQTQLQPQVPGQQPAQPQSHQQMRTLNPLGNNPMNIPAGGITTDQ
QPPNLISESALPASLGATNPLMNDGSSPANIGTLSTIPTAAPPSSTGVRKGWHEHVTQDL
RSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYK
IQKELEEKRRSRLHKQGILGNQPALPAPGAQPPGIPQAQPVRPPNGPMPLPVNRVQVSQG
MNSFTPMSLGNVQLPQAPMGPRAASPMNHSVPMNSMGSVPGMAISPSRMPQPPNMMGTHA
NNIMAQAPAQNQFLPQNQFQSSSGAMSVNSVGMGQPAAQTGVPQGQVPGAALPNPLNMLG
PQASQLPCPPVTQSPLHQTPPPASTAAGVPSLQHPTAPGMTPPQPAAPTQPSTPVSSSGQ
TPTPTPGSVPSASQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHAQPP
GTPLSQAAASIDNRVPTPSSVASAETSSQQPGPDVPMLEVKAEVKTEDTEPDASESKGEP
GSAMMEEDLQGSSQVKEETDTTEQKSEPMEVDEKKPEVKVEAKEEEENNANGAASQSTSP
SQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLST
IKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
YCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQ
PQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGR
TRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKS
RFVDSGEMSDSFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSI
HFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPK
RLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELE
QEEEERKKEESTAACETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDL
SQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWE
FSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKS
HAHKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQK
MKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQH
RLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPGTPQTPQPPAQPQPSPVSMS
PAGFPSVARTQPPTTVSTGKPTNQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRVNV
NNGLPPGRAGMVTPVSQMAPVGLNVPRPSQVSGPVMPNLPPGQWQQAPLPQQQPMPGLPR
PVLSMQAQPAVAGPRMSGVQPPRSISPGALQDLLRTLKSPSSPQQQQQVLNILKSNPQLM
AAFIKQRTAKYVASQPGLQPQPSLQPQPGLQAQPGLHQQPGLQNLNAMQASGPRPGVPPQ
QPAMGGLNPQGQALNIMNPGHNPSMASMNPQYREMLRRQLLQQQQQQQQQQQQQQQQGST
GMAGGMAGHGQFQQPQGPGGYPPAMQQQRMQQHLPIQGSSMGQMAAQMGQLGQIGQPGLG
ADSTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQMATSLS
SQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSIDQGHL
GNPEQSAMLPQLNTPNRSALSSELSLVGDTTGDTLEKFVEGL
NT seq 7329 nt   +upstreamnt  +downstreamnt
atggccgagaacttgctggacggaccgcccaatcccaaacgagccaaactcagctcgccc
ggcttctcggcgaatgacagcacagattttggatcattgtttgacttggaaaatgatctt
cctgatgagctgatccccaatggaggagaattaagccttttaaacagcgggaaccttgtt
ccagatgctgcttccaaacacaagcaactgtcggagcttctgcgtggaggcggcggctct
agtatgaacccaggaataggaaatgtcagcgccagcagccccgcgcagcaaggcctgggc
ggccaggcacaagggcagccgaacagcgcgaacatggccagcttgggtgccatgggcaag
agccctctgaaccagggagattctgcagcccccagcctgcccaagcaggcagccagcacc
tccgggcccactccccctgcttcccaagcactgaatccgcaagcacaaaagcaagtgggg
ctggtgactagcagccctgccacgtcgcagacgggacctgggatctgcatgaacgctaac
ttcaaccagacccacccgggcctcctcaatagtaactctggccacagtttaatgaaccag
gcccagcaaggacaggcgcaggtcatgaatggatctcttggggccgcaggcagaggaagg
ggagctgggatgccgtaccctgctccagccatgcagggggccgcgagtagtgtgctggcc
gagacgttaacccaggtttcaccgcaaatggccagtcacgccggactgaacacggcgcag
gcaggaggcatgaccaaggtgggaatgactggtaacacaagtccgttcggacaacccttc
agtcagactggagggcagcagatgggagcccctggagtgaacccccagttatccagcaaa
cagagcatggtcaacagtttgcctcccttccctacggacatcaagaatgcttcagtcacc
aacgtgccaaacatgtctcagatgcagacttcagtgggaattgtccccacacaggcgatt
gcggcgggccccaccgcggaccctgagaagcgcaagctcatacagcagcagctggttctc
ctgcttcacgcccacaagtgtcagagacgagagcaagcgaatggagaggtccgggcctgc
tctctcccacactgtcgaaccatgaaaaatgttttgaatcacatgacacattgtcaggct
gggaaagcctgtcaagttgcccattgtgcatcttcacgacaaatcatctctcattggaag
aactgcacacgacatgactgtcctgtttgcctccctttgaaaaatgccagtgacaagcga
aaccaacaaaccatcctggggtctccagctagtgggattcagaacacgattggttctgtt
ggcacaggccagcagaacgccgcgtctttaagtaacccaaatcccatagaccccagctcc
atgcagcgcgcgtacgctgctctcggactcccctacctgaaccagccccagacgcagctg
cagcctcaggttcccggccagcaaccagcacagcctcaaagtcaccagcagatgaggact
ctcaaccccctgggaaataacccaatgaacattccagcaggaggaataacaacggatcag
cagccaccaaacttgatttcagaatcagctcttccagcttccctcggggccacaaacccc
ttgatgaacgatggctcgagccctgcaaacattgggaccctcagcactataccgacagcg
gcccctccttccagcaccggcgttcggaaaggctggcacgaacatgtcactcaggacctg
cggagccatttagtgcataaactcgtccaagccatctttccaacccccgacccggcagcc
ctgaaggatcgccgcatggagaacctggtggcctacgctaagaaggtggagggggacatg
tatgagtctgccaacagcagggatgaatactatcacttactggcagaaaaaatctacaag
atacaaaaagaactagaagaaaaacggaggtcgcgtttgcacaaacaaggcatcttgggt
aaccagcctgccctgccggctcccggggcgcagcccccagggattccgcaggcacagcct
gtgaggcctccaaacggacccatgcccctgccagtgaaccgcgtgcaggtgtcccaaggg
atgaattcatttaccccaatgtccttggggaatgtacagttgccacaagctcccatggga
ccacgtgcagcgtcccccatgaaccactctgtcccgatgaacagcatgggctccgttcca
gggatggccatctctccttcccggatgcctcagcctccaaacatgatgggcactcacgcc
aacaacattatggcccaggcgcctgcgcagaaccagttcctgccgcagaaccagttccag
tcctccagtggggcgatgagtgtgaacagtgtgggcatggggcagccggcggcccagaca
ggcgtgccacagggacaggtgcctggtgctgctcttcctaaccctctgaacatgcttggg
ccccaagccagccagctgccctgcccgccagtgacacagtcaccgttgcaccagacacca
ccgcctgcttccacggccgctggcgtgccgtctctccagcacccaacggcgcctggaatg
actcctccccaaccagcagctcccacccagccgtcgactcccgtgtcgtcttccgggcag
actcccaccccgactcccggctcagtgcccagtgctagccagacccagagcacccctacg
gtccaggcagcagcccaggcccaggtgaccccacagcctcagaccccagtccagcccccg
tctgtggccacccctcagtcatcacagcagcagccaacgcctgtgcacgcccagcctcct
ggcacgccgctttcccaggctgcagccagcatcgataacagggtccctactccttcctcg
gtggccagtgcggaaaccagctcccagcagccaggacccgatgtaccaatgctggaagtg
aaggcagaggtcaagaccgaggacactgagcctgacgccagtgaatccaagggggagcca
ggctctgcgatgatggaggaggatctacaaggatcttctcaagttaaagaagaaacagac
acaacggaacagaaatcagaacccatggaagtggacgagaagaaaccggaagtcaaagta
gaagctaaagaggaagaagagaacaacgctaatggggccgcctctcagtcaacgtctcct
tcacagccacgcaaaaaaatcttcaagccggaggagttacgccaggctcttatgccaacg
ctcgaagcgctatatcgacaggacccggagtccctacctttccggcagcctgtagacccc
cagctcctaggaattccggattattttgatattgtgaagaatcccatggacctttccacc
atcaagcggaagctggatacagggcagtaccaagagccctggcagtacgtggacgacgtc
tggcttatgttcaacaacgcctggctctataaccgtaagacgtcccgggtctataagttc
tgcagtaaacttgcagaggtcttcgagcaagagattgaccctgtcatgcagtcccttgga
tattgctgtggacgcaagtatgagttttccccacagactttgtgctgctacgggaagcag
ctgtgcacaattcctcgtgacgctgcctactacagctatcagaataggtatcatttctgt
gagaagtgtttcacagagatccagggggagaatgttaccctgggtgacgacccttcacag
ccccagacgacaatttcaaaggatcagtttgaaaagaagaaaaatgataccttagatcct
gaaccctttgtcgattgcaaggagtgtggccgcaagatgcaccagatttgtgttctgcac
tatgacatcatttggccttcaggctttgtgtgtgacaactgtttgaagaaaactggcaga
actcggaaagaaaacaagttcagtgctaagagactacagaccacacgattgggcaaccac
ctggaagaccgagtcaacaagtttttgcggcgacagaatcatcctgaagccggggaggtc
tttgtccgtgtggtggccagttcagacaagactgtggaggtcaagcccgggatgaagtca
cggtttgtggattctggggaaatgtctgactctttcccctatcgaaccaaagcactcttt
gcttttgaggaaattgacggagtggacgtgtgcttctttgggatgcacgtgcaagagtat
ggctctgattgccccccgccaaacacaaggcgtgtgtacatatcttatctagacagtatt
catttcttccggccccgatgcctccggacagctgtttaccatgagatccttattggatat
ttagaatatgtgaagaaactggggtatgtcacaggacacatctgggcctgccccccaagt
gaaggagacgactatatcttccattgccacccccctgaccagaaaatccccaaaccaaag
cgcctccaggagtggtacaagaagatgctggacaaggcattcgcggagcggatcattcac
gactacaaggatatcttcaaacaagcaactgaagacaggctcaccagtgccaaggagctg
ccctactttgagggtgacttctggcccaacgtgctggaggagagcattaaggagctggag
caggaggaagaggagaggaagaaggaggagagcactgcggcctgcgagaccacggagggc
agccagggcgacagcaagaacgccaagaagaagaacaacaagaaaaccaacaagaataaa
agcagcatcagtcgagccaacaagaagaagcccagcatgcccaacgtgtccaacgacttg
tcccagaagctctacgccacgatggagaagcacaaagaggtcttctttgtgatccacctg
cacgctgggcccgtcatcaacacactgccccccatcgtggaccccgaccccctgctcagc
tgtgacctcatggacgggcgtgacgccttcctcaccctcgcccgagacaagcactgggag
ttctcctccttgcgccggtccaagtggtccacactgtgcatgctggtggagctgcacacc
cagggccaggaccgcttcgtctacacctgcaacgagtgcaagcaccacgtggagacgcgc
tggcactgcaccgtctgcgaggactacgacctctgcatcaactgctacaacaccaagagc
cacgcccacaagatggtgaagtgggggctgggcctggacgacgagggcagcagccagggc
gagccgcagtccaagagcccccaggagtcgcggcgcctgagcatccagcgctgcatccag
tccctggtgcacgcctgccagtgccgcaacgccaactgctcgctgccgtcctgccagaag
atgaagcgggtggtgcagcacaccaagggctgcaagcgcaagaccaacgggggctgcccg
gtgtgcaagcagctcatcgccctctgctgctaccacgccaagcactgccaggagaacaag
tgcccggtgcccttctgcctcaacatcaaacacaagctccggcagcagcagatccagcac
cggctgcagcaagcccagctcatgcgccggcggatggccaccatgaacacccgcaacgtg
cctcaacagagtctgccttcccctacctcagctccgcccgggacccccacgcagcagccc
ggcacgccccagacgccgcagcccccggcccagccccagccctcacccgtgagcatgtca
ccagccggcttccccagcgtggcccggactcagccccccaccacggtgtccaccgggaag
cccaccaaccaggtgccggccccgccgccccctgcacagcccccaccggccgcggtggaa
gcggcccggcagatcgagcgcgaggcccagcagcagcagcacctgtaccgggtgaacgtg
aacaacggcctgcccccggggcgcgcgggcatggtgaccccggttagccagatggcccct
gtgggcctgaacgtgccccgtcccagccaggtcagcgggccggtcatgcccaacctgccc
cccgggcagtggcagcaggcgcctcttccccagcagcagccgatgccgggcctgccccgg
cccgtgctgtccatgcaggcccagccggccgtggccgggccgcggatgtccggcgtgcag
cctccccggagcatctcgcccggcgccctgcaggacctgctgcggaccctgaagtcgccc
agctccccgcagcagcagcagcaggtgctcaacatcctcaagtccaaccctcagctgatg
gcggccttcatcaagcagcgcacagccaagtacgtggccagtcagcccggcctgcagccc
cagcccagcctgcagccccagcccggcctccaggcccagcccggcctgcaccagcagccc
ggcctgcagaacctgaacgccatgcaagccagcgggccccggcccggtgtgcctccacag
cagcctgcgatgggaggcctgaacccccagggccaggccctgaacatcatgaacccgggc
cacaaccccagcatggcgagcatgaacccacagtaccgggagatgctccggaggcagctg
ctccagcagcagcagcagcaacagcagcagcagcaacagcagcagcagcagggcagcacg
ggcatggccgggggcatggccgggcatggccagttccagcagccccagggacccggaggc
taccccccggccatgcagcagcagcggatgcagcagcacctccccatccagggcagctcc
atgggccagatggcagctcagatgggacagctcggccagatagggcagccggggctgggc
gcagacagcacccccaacatccagcaggccctgcagcagcggattctgcagcagcagcag
atgaagcagcagatcgggtccccgggccagccgaaccccatgagcccccagcagcacatg
ctctcaggacagccgcaggcctcgcacctccccggccagcagatggccacgtccctcagt
agccaggtgcggtctccggcccctgtccagtctccgcggccccagtcccagcctccacat
tccagcccgtcgccacggatacagccccagccttcaccacaccacgtctcgccccagact
ggttccccccacccaggactcgcagtcaccatggccagctccatagatcagggacacttg
gggaaccccgaacagagtgcaatgctcccacagctgaacacccccaacaggagtgcactg
tccagtgagctgtccctggtcggcgacaccacaggagacaccctagaaaagtttgtggag
ggtttgtag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111157665
Entry
111157665         CDS       T05871                                 

Definition
(RefSeq) histone acetyltransferase p300
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04024  cAMP signaling pathway
elk04066  HIF-1 signaling pathway
elk04068  FoxO signaling pathway
elk04110  Cell cycle
elk04310  Wnt signaling pathway
elk04330  Notch signaling pathway
elk04350  TGF-beta signaling pathway
elk04520  Adherens junction
elk04630  JAK-STAT signaling pathway
elk04720  Long-term potentiation
elk04916  Melanogenesis
elk04919  Thyroid hormone signaling pathway
elk04922  Glucagon signaling pathway
elk04935  Growth hormone synthesis, secretion and action
elk05016  Huntington disease
elk05152  Tuberculosis
elk05161  Hepatitis B
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05200  Pathways in cancer
elk05203  Viral carcinogenesis
elk05206  MicroRNAs in cancer
elk05211  Renal cell carcinoma
elk05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111157665
   04330 Notch signaling pathway
    111157665
   04350 TGF-beta signaling pathway
    111157665
   04630 JAK-STAT signaling pathway
    111157665
   04066 HIF-1 signaling pathway
    111157665
   04068 FoxO signaling pathway
    111157665
   04024 cAMP signaling pathway
    111157665
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111157665
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111157665
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    111157665
   04935 Growth hormone synthesis, secretion and action
    111157665
   04919 Thyroid hormone signaling pathway
    111157665
   04916 Melanogenesis
    111157665
  09156 Nervous system
   04720 Long-term potentiation
    111157665
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111157665
   05206 MicroRNAs in cancer
    111157665
   05203 Viral carcinogenesis
    111157665
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    111157665
   05215 Prostate cancer
    111157665
  09164 Neurodegenerative disease
   05016 Huntington disease
    111157665
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111157665
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111157665
   05161 Hepatitis B
    111157665
   05164 Influenza A
    111157665
   05167 Kaposi sarcoma-associated herpesvirus infection
    111157665
   05165 Human papillomavirus infection
    111157665
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111157665
   03036 Chromosome and associated proteins [BR:elk03036]
    111157665
   03029 Mitochondrial biogenesis [BR:elk03029]
    111157665
Enzymes [BR:elk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     111157665
Transcription factors [BR:elk03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    111157665
Chromosome and associated proteins [BR:elk03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    111157665
Mitochondrial biogenesis [BR:elk03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    111157665
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 111157665
NCBI-ProteinID: XP_022374989
UniProt: A0A2Y9KUN9
LinkDB
Position
Unknown
AA seq 2425 aa
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
INQLQTSLGIVQDAASKHKQLSELLRSGSSPNLSMGVGGPGQGMASQPQQNSPGLGLINS
MVKSPMAQAGLTSPNMGMGTSGPNQGPTPSAAGMMNSPVNQPALGMNTGMNAGMNPGMLN
AGNGQGMMPNQVMNGSIGAGRGRPNMQYPNPGMGNAGNLMPEPLQQGSPQMGGQTGLRGP
QPIKMGMMNNPNPYGSPYTQNSGQQIGASGLGLQIQTKSVLPNNLSPFAMDKKAVPGGGM
PNMGQQQAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANG
EVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKN
AGDKRNQQSILTGAPVGLGNTSSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQ
MPTQPQVQAKNQQNQQSGQSPQGMRPMSNMSASPMGVNGGVGVQTPNLLSDSMLHSAINS
QNPMMSENASVASLGPMPTAAQPSNTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAA
LKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLP
SAAGMVPVSMNPGPNMGQPQPGMTTNGPLPDPSMIRGSVPNQMMARITPQPGLNQFGQMS
MPQPPIGPRQTSPLQHHGQLAQPGTLNPPMGYGPRMQQPSSQSQFLPQTQFSAQGMNVTN
MPLAPSGGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPPLPQSALHQNSPSPVPSRT
PTPHHTPPSIGAQQPPATAIPAPVPTPPAMPPGPQTQALHPPPRQTPTPPPTQLPPQVQP
SLPAAPSADQPQQQPLSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSS
TEVSSQTIPEKQPSQEVKMEAKMEVEPPEPADAQPEDIAESKAEDCKMEPTETEERGTEL
KTETKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPV
DPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVY
KYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYH
FCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICV
LHHEIIWPSGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESR
RITVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQ
EYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACP
PSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAK
ELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKN
KSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLI
PCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVET
RWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNSQQAAATQSPGDSRRLSIQRCI
QSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQEN
KCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPT
GQQPATPQTPQPQPPSQPQPAPPSSMPPYLPRTQPAGPVSQGKAAGQVTPPTPPQTAQPP
LPGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPQMTPMAPMGMNPPMTRGPSG
HLEAGMGPAGMQQQPQWVQGGLPQPQQLQPGMPRPPAMMSVAQHGQPLNIAPQPGLGQVG
VSPLKPGGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYASSN
PQPLPGQPGLPQGQPALQPPTLPGQQGVHANPALPNMNPMQAGVQRAGLPQQQPQQQLQP
PMGGMSPQAPQMNMNHSTMPSQFRDILRRQQMMQQQQQQGAGPGIGPGMANHNQFQQPQG
VGYPPPPPPPPQQPQPPRMQHHMQQMPQGSMGQMGQLPQALGAEAGASLQAYQQRLLQQQ
MGSPAQPNPMSPQQHMLPSQAQSPHLQGQQIPSLSNQVRSPQPVPSPRPQSQPPHSSPSP
RMQPQPSPHHVSPQTSSPHPGLVAAQANPMEQGHFASPDQSSMLSQLASNPGMANLHGAS
ATDLGLSTDNSDLNSNLSQSTLDIH
NT seq 7278 nt   +upstreamnt  +downstreamnt
atggccgagaatgtggtggaaccggggccgccttcagccaagcggcctaaactctcatct
ccggccctctcggcgtcggccagcgatggcacagattttggctctctctttgacttggag
catgacttaccagatgagttaatcaactctacagaactgggactgaccaatggtggtgat
attaatcagcttcagacaagtcttggcatcgtacaggacgcagcctctaagcataagcag
ctgtcggaattgctacggtctggtagttcccctaacctcagtatgggggttggtggccca
ggccaaggcatggccagccagccccaacagaacagtcctggattaggtttgataaatagc
atggttaaaagcccaatggcacaggcaggcttgacttctcccaacatggggatgggcact
agtggaccgaatcagggtcctacgccatctgcagcaggtatgatgaacagtccggtaaat
cagcctgccctgggaatgaacacagggatgaatgctggcatgaatcctggaatgttgaat
gcaggcaatggacaggggatgatgcctaatcaagtcatgaacggttcaattggagcaggc
cgggggcgacctaatatgcagtacccaaacccaggcatgggaaatgctggcaatttaatg
cccgagccactgcagcaaggctctcctcagatgggaggacagacgggattgagaggccct
cagccgattaagatgggaatgatgaacaaccctaatccttacggttcaccatacactcag
aattctggacagcagattggagccagtggccttggtctccagattcagacgaagtctgta
ctaccaaataacttatctccatttgccatggacaaaaaggcagttcctggtggaggaatg
cccaacatgggtcaacagcaggccccacaggtccagcagccaggccttgtgactccagta
gctcaagggatgggttctggagcgcacacagccgacccagagaagcgcaagctcatccag
cagcagctggttctccttttgcacgctcacaagtgccagcgcagggagcaggctaatggg
gaagtgaggcagtgcaaccttccccactgtcgcacaatgaagaacgtcctaaaccacatg
acacactgccagtcaggcaagtcctgccaagtggcacactgtgcatcttctcgacaaatc
atttcacactggaagaattgtacgagacatgattgtcctgtgtgtctgccccttaaaaat
gctggagataagagaaatcaacagtcaattctgactggagcaccagttggacttggaaat
actagctctctcggggtgggtcagcagtctacccccagcctaagcactgttagtcagatt
gatcccagctctatagaaagggcctatgcagctcttgggctgccctatcaagtaaatcag
atgccgacacagccacaggtgcaagcaaagaaccagcagaatcagcagtctgggcagtca
ccccaaggcatgcggcccatgagcaacatgagtgctagtcctatgggagtaaatggaggt
gtaggggttcagacgccgaatcttctctctgactcaatgttgcattcagccataaattct
caaaacccaatgatgagtgaaaatgccagtgtggcctccctgggtcctatgccaacagca
gctcaaccatccaatactggaattcggaaacaatggcatgaagatattactcaggatctt
cgaaatcatcttgttcacaaacttgttcaagccatatttcctactccggatcctgctgct
ttaaaagaccgacggatggaaaacttagttgcatacgcccggaaagtggaaggggacatg
tatgaatctgcaaataatcgagcggagtactaccacctgctcgctgagaagatttataag
atccagaaagaactagaagaaaaacgaaggactagactacagaaacaaaacatgctgcct
agtgccgcaggcatggtgccggtttctatgaatccggggcccaatatgggacagccacaa
ccaggaatgactaccaatggccctctacctgacccctctatgatccgtggcagtgtgcca
aaccagatgatggctcggataactccacagcctggtttgaatcagtttggccagatgagt
atgccccagcccccaattggaccccggcagacctctcctcttcagcaccatggacagtta
gctcagcctggaactctcaacccacctatgggctatgggcctcgcatgcagcagccttcc
agccagagccagttccttccccagactcagttctcagcacagggaatgaatgtaacgaat
atgcctttggctccgtctggcggtcaagcaccagtgtctcaagcacaaatgtccagttct
tcctgccctgtgaactctcctataatgcctccagggtctcaagggagccacattcactgt
ccccctctccctcagtcagctctgcatcagaattcaccctctccagtacctagtcgcacc
cctacgcctcaccacactcccccaagcataggggctcagcagccaccagcaacagcaatt
ccagcccctgttcctacacctccagccatgccacccgggccacagacccaggctctacat
ccgcctccaaggcagacacctacaccaccaccaacgcaacttcctcctcaagttcagcct
tcacttcctgctgctccttcagctgaccagccccagcagcagcctctctcccagcagagt
acagcagcatctgttcccaccccgacagcgccgctgctgcccccacagcctgcgactcca
ctttcccaaccagctgtaagcattgaagggcaggtatcaaaccctccatccactagtagc
acagaagtgagttctcagaccattcctgagaagcagccttcacaggaagtgaaaatggag
gcaaagatggaagtggagccaccagaaccagcagatgctcagccagaggatatcgcagag
agtaaagcagaagactgtaaaatggaacctacagaaacagaagagagaggcactgaatta
aaaaccgaaacaaaagaggaggaagaccagccaagtacttcggctacccagtcatctcca
gccccgggacagtcaaagaagaagattttcaaaccagaggagttacgacaggcactgatg
ccaactttggaggcactttaccgacaggatccagaatcccttccctttcgtcaacctgtg
gaccctcaacttcttggaatccctgattactttgatattgtgaagagccccatggatctt
tctaccatcaagaggaagttagacactggacagtatcaggaaccctggcagtatgtggat
gacatttggcttatgttcaacaatgcctggttgtataatcggaaaacatctcgggtatac
aagtattgctccaagctgtctgaagtctttgaacaagaaattgacccagtaatgcaaagc
cttggatattgttgtggcagaaagttggagttttctccacagacactctgttgctatggc
aaacagttgtgcacaatccctcgtgatgccacttactacagttaccagaacaggtatcat
ttctgtgagaagtgtttcaatgaaatccaaggggagagcgtttctttgggggatgaccct
tcccagcctcaaactacaataaataaagaacaattttccaagagaaaaaatgacacactg
gatcctgaactgtttgttgaatgtacagagtgtggaagaaagatgcatcagatctgtgtc
cttcatcatgaaatcatctggccatctggatttgtctgtgatggctgcttaaagaaatct
gcacgaaccaggaaagaaaataagttttctgctaaaaggctgccatctaccaggcttggc
acctttctggaaaaccgtgtgaatgactttcttaggagacaaaaccaccctgaatccagg
agaatcactgttcgggtagttcatgcttctgacaagactgtggaagtgaagccaggcatg
aaagcaaggtttgtagatagtggagagatggcagaatcctttccataccgaaccaaagcc
ctctttgcctttgaagagatagatggcgtcgacttgtgcttctttggcatgcatgttcaa
gagtatggctctgactgccctccacccaaccagaggagagtttacatatcatacctcgac
agtgttcatttcttccgtcctaagtgcttgaggaccgcagtctatcatgaaattctaatt
ggatatttagaatacgtcaagaaattaggatacacgacagggcatatttgggcttgtccg
ccaagtgagggagatgactatatcttccactgccatcctcctgaccagaagatacccaag
cccaagcgactgcaggagtggtacaaaaagatgcttgacaaggccgtgtctgagcgaatc
gtccatgactacaaggatatttttaaacaagctactgaagatcgattaacaagtgcaaag
gagttgccttactttgagggtgatttctggcccaacgttctggaagagagcattaaggaa
ctggaacaggaggaagaagagcgaaagcgagaggaaaacaccagcaatgagagcacagat
gtgacaaagggagacagcaaaaatgctaaaaagaaaaataataagaaaaccagcaaaaac
aagagcagcctgagtaggggcaacaagaagaagccgggcatgcccaacgtatccaacgac
ctctcgcagaagctgtatgccacaatggagaaacacaaagaggtcttctttgtgatccgt
ctcatcgctggccctgccgccaactccctgcctcccattgttgatcctgaccccctcatc
ccctgcgatctgatggatgggcgggatgccttccttaccctcgcgagggacaagcacctg
gagttctcttcactccgaagagcccagtggtccaccatgtgcatgctggtggagctgcac
acccagagccaggaccgcttcgtctacacctgcaatgagtgcaaacaccacgtggagacg
cgctggcactgcaccgtctgtgaggattatgatttgtgtatcacctgctataacactaaa
aaccatgaccacaaaatggagaaactgggtctcggcttagacgacgagagcaacagccag
caggctgcggccacccagagcccgggagactctcgccgcctgagcatccagcgctgcatc
cagtccctggtgcacgcctgccagtgccgcaacgccaactgctcgctgccgtcctgccag
aagatgaagcgggtggtgcagcacaccaagggctgcaagcgcaagaccaacgggggctgc
cccatctgcaagcagctcattgcgctctgctgctaccacgccaagcactgccaggagaac
aagtgccccgtgcccttctgcctcaacatcaagcagaagctccggcagcagcagctgcag
caccggctccagcaggcgcagatgctccgcaggaggatggccagcatgcagcggaccggg
gtggtggggcagcagcagggcctgccctccccgactcctgccactcccaccacgcccacg
ggccagcagccggccacgccgcagacgccgcagccccagcctccctcccagcctcagccc
gcccctcccagcagcatgccgccctacctgcccaggactcagcctgctggccctgtctcc
cagggtaaggcggcgggccaggtgacccctcccaccccccctcagactgctcagccaccc
ctcccggggcccccgcccgccgcggtggaaatggccatgcagattcagagggcggctgag
acgcagcgccagatggcccacgtgcaaatttttcaaaggccaatccagcaccagatgccc
cagatgactccaatggcccccatgggtatgaacccacccatgaccagaggtcccagcggg
catctggaggcagggatggggcccgcagggatgcagcagcagccccagtgggtgcaggga
ggattgcctcagccccagcagctacagcctgggatgccgcggccgccagccatgatgtcg
gtggcccagcatggccagcccttgaatatcgctccccagccgggactgggccaggtaggt
gtgagccctctcaaaccaggcggcactgtgtctcaacaagccttacaaaaccttttgcgg
actctcaggtctcccagctctcccctacagcagcaacaggtgctcagtatccttcacgcc
aacccccagctgctggctgcgttcatcaagcagcgggccgccaagtacgccagctcgaat
ccgcagcccctccctgggcagcccggcctgccccagggccagccggcactgcagccaccc
accctgccgggccagcaaggggtgcacgctaatccagccctgcccaacatgaaccccatg
caggcgggcgtccagagggccggcctgccccagcagcagccgcagcagcagctccagccg
cccatgggcgggatgagcccccaggctccgcagatgaacatgaaccacagcaccatgcct
tcgcagttccgagacatcctgaggcggcagcagatgatgcagcagcagcagcagcaggga
gcagggcccggaatcggccccgggatggccaaccataaccagttccagcaaccccaagga
gtcggctaccccccgccgccgccaccgccgccccagcagccacagccgccgcggatgcag
caccacatgcagcagatgccgcaagggagcatggggcagatgggccagctcccgcaggcc
ttgggggcagaggccggagccagcctgcaggcgtatcagcaacgactcctccagcagcag
atggggtcccctgcccagcccaaccccatgagcccccagcagcatatgctccccagccag
gctcagtccccacacctccaaggccagcagatcccttctctctccaatcaagtgcgttct
ccccagcctgtcccttctcctcggccacagtcccagcccccccactccagcccttcccca
aggatgcagcctcagccttcaccacaccacgtttccccacagaccagttctccacatcct
gggctggtagctgcccaggccaaccccatggaacaagggcattttgccagcccggaccag
agttcaatgctctctcagctcgctagcaatccaggcatggcaaacctccatggtgcaagc
gccacggacctgggactcagcaccgataactcagacttgaattcaaacctctcacagagt
acactagacatacactag

DBGET integrated database retrieval system