KEGG   Enhydra lutris kenyoni (northern sea otter): 111156259
Entry
111156259         CDS       T05871                                 

Definition
(RefSeq) tuberin isoform X1
  KO
K07207  tuberous sclerosis 2
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04072  Phospholipase D signaling pathway
elk04115  p53 signaling pathway
elk04140  Autophagy - animal
elk04150  mTOR signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04152  AMPK signaling pathway
elk04211  Longevity regulating pathway
elk04218  Cellular senescence
elk04714  Thermogenesis
elk04910  Insulin signaling pathway
elk04919  Thyroid hormone signaling pathway
elk05163  Human cytomegalovirus infection
elk05165  Human papillomavirus infection
elk05168  Herpes simplex virus 1 infection
elk05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    111156259
   04151 PI3K-Akt signaling pathway
    111156259
   04152 AMPK signaling pathway
    111156259
   04150 mTOR signaling pathway
    111156259
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111156259
  09143 Cell growth and death
   04115 p53 signaling pathway
    111156259
   04218 Cellular senescence
    111156259
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111156259
   04919 Thyroid hormone signaling pathway
    111156259
  09149 Aging
   04211 Longevity regulating pathway
    111156259
  09159 Environmental adaptation
   04714 Thermogenesis
    111156259
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    111156259
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111156259
   05163 Human cytomegalovirus infection
    111156259
   05165 Human papillomavirus infection
    111156259
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:elk01009]
    111156259
Protein phosphatases and associated proteins [BR:elk01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111156259
SSDB
Motif
Pfam: Tuberin DUF3384 Rap_GAP Cnd1 HEAT Telomere_reg-2
Other DBs
NCBI-GeneID: 111156259
NCBI-ProteinID: XP_022372735
UniProt: A0A2Y9KU76
LinkDB
Position
Unknown
AA seq 1813 aa
MAKPTSKDSGLKEKFRNLLGLGTPRPNPRSAEGKQTEFIITADILRELSVECGINSRIRV
IGQICEVAKMKKFEEHAVEALWKAVADLLQPERPPEARHAVLALLKAIVQGQGDHLGVLR
ALFFKVIKDYPSNEDLHERLEVFKALTDNGRHITYLEEELAGFVLQWMDIGLSSEFLLVL
VNLVKFNSCYLDEYIASMVHMICLLCVQTVSSVDIEVSLQVLDAVVCYNCLPAESLPLFI
VTLCRTINVKELCEPCWKLMRNLLGTHLGHSAIYNMCRIMEDRAYKEDAALLRGAVFFVG
MALWGAHRLYSLKNSPTSVLPSFYEAMTCPNEVVSYEIVLSVTRLIKKYRRELQAVTWDI
LLNIMERLLQQLQSLDSPELRAVVHDLLTTVEELCDQSEFHGSPERYFELVERCADQRPE
SSLLNLITYRAQSIHPAKDGWIHNLQLLMERFFRNESRSAVRIKVLDVLSFVLLINRQFY
EEELISSVVISQLSHVPEDKDPQVRKLATQLLVDLAEGCHTHHFNSLLDIVEKVMSRSLS
PPAELEERDVAAYSASVEDVRTAVLGLLVILQTKLYSLPASHAMRVYETLVGHIQLHYKH
DYTLPIAASIRMQAFDFLLLLRADSLHRLGLPSKDGAVRFSPYCVCDAMEPERGPEKKAS
GALSNPTGPPGPTPTGPAVRLGSLPYSLLFRVLLQCLKQEADWKVLKLVLGKLPESLRYK
VLIFTSPCSVDQLSAALCSMLSGPRTLERLRGTPEGFSRTDLHLAVVPVLTALISYHNYL
DKTRQREMVYCLEQGLIYRCASQCVVALAICSVEMPDIIIKALPVLVVKLTHISATASMA
VPLLEFLSTLARLPHLYRNFAAEQYASVFAISLPYTNPSKFNQYIVCLAHHVIAMWFIRC
RLPFRKDFVPFITKGLRSNVLLSFDDTPEKDSFRARSTSLNERPKSLRIARTPKQGLTNS
PPVKERKESSATEAFRCRSISVSEHVVRSRIQTSLTSASLGSADENSMAQADDNLKNLHL
ELTETCLDMMARYVFSNFTAVPKRSPVGEFLLAGGRTKTWLVGNKLVTVTTSVGTGTRSL
LGLDSGELPGGPELSTDPGAHVRQTKEAPAKLESQAGQQVCRGARDRVRSMSGGHGLRVG
ALDTPASHFTGGPTSSGAQMAPASKPERASAGTQFPAQEKTSLAAYVPLLTQGWAEILVR
RPTGNTSWLMSLENPLSPFSSDINNMPLQELSNALMAAERFKERRDTALYKSLSVPAAGS
AKPPPPPRSNTVASLSSLCQSSCRAQLHRGVSWADSAVVPEEGSLSESRLPTEPTELEDF
EATLGTDRRGGRAEAYSRSSSSSSQEERFPAEEAAAGGIPIERAVSSEGARPSAELPFQP
SQPLSKSSSSPELQTLQDILGGPGDKTDVGRLSPEAKARSQSGILDGTGASWSAPGEESQ
VQGPAQPEGPLPSSCPRSPSGLRPRGYTISDSAPSRRGKRVERDAFKSRTGASNTEKVPG
INPSFVFLQLYHSPFFGDESNKPILLPSESFERSVQLLDQIPSYDTHKIAVLYVGEGQSN
SELAILSNEHGSYRYTEFLTGLGKLIELKDCQPDKVYLGGLDVCGEDGQFTYCWHDDIMQ
AVFHIATLMPTKDVDKHRCDKKRHLGNDFVSIIYNDSGEDFKLGTIRGQFNFVHVIITPL
DYECNLVSLQCRKDMEGLVDTSVAKIVSDRNLPFVARQMALHANMASQVHHSRSNPTDIY
PSKWIARLRHIKRLRHRIQEEAQYSSPSLPLLQTHTPGHGKAPAPAPAEPVPAYETGQRK
RLISAVDDFTEFV
NT seq 5442 nt   +upstreamnt  +downstreamnt
atggccaagccgacaagcaaagattcaggcctgaaggagaaattcaggaatctgttagga
ctgggaaccccgaggccaaaccccaggtctgcagagggcaaacagacggagtttatcatc
acggccgacatcctgagagaactgagtgtcgaatgtggtatcaacagtcgcatccgggtg
atagggcagatctgcgaggttgccaaaatgaagaaatttgaagagcacgcggtggaggcg
ctgtggaaggccgtggcggacctgctgcagccggagcggcccccggaggcccggcacgcg
gtgctggctctgctgaaggccatcgtgcaggggcagggggaccacctgggcgtgctcaga
gccctcttctttaaggtcatcaaggattacccctccaatgaagacctccacgagagactg
gaagtgttcaaggccctcacggacaacgggagacacatcacctacttggaagaagaactg
gctgggttcgtgctgcagtggatggacatcggcctgtcctcagaatttctcttggtgctt
gtgaacttggtcaagttcaacagctgttacctggatgaatacattgcatcgatggtccac
atgatctgcctgctgtgtgtccagacggtgtcgtccgtagacatagaggtctccctgcag
gtgctggacgccgtggtctgctacaactgcctgccggctgagagtctcccgctgttcatt
gtgactctctgccgcaccatcaacgtcaaggagctctgtgagccttgctggaagctgatg
cgtaacctcctgggcacccacctgggccacagtgccatctacaacatgtgtcggatcatg
gaggacagagcctacaaggaggacgccgcgctgctgagaggcgccgtgttctttgtgggc
atggctctctggggcgcgcaccgactctactctctgaagaactccccaacatctgtgctc
ccgtccttttatgaggccatgacctgtccgaacgaggtggtgtcctacgagattgtgctc
tccgtaaccagactgatcaagaagtaccggagggagctccaggccgtgacgtgggacatc
ctgctgaacatcatggagcgcctgctgcagcagctccagagcctggacagcccagagctc
agagccgtcgtccacgacctgctgaccacagtggaagagctgtgcgatcagagcgagttc
cacgggtctccggagagatactttgagctggtcgagcgatgcgcagaccagaggcctgag
tcctcgctcttgaacttaatcacatacagggctcagtcgatccatccggccaaggacggc
tggattcacaacctgcagctgctgatggagaggttcttccggaacgagtcccgcagtgcc
gtgcgcatcaaggtgctggacgtcctgtccttcgtgctgctcatcaacaggcagttctat
gaggaggagctgatcagctcagtggtcatctcacaactctcccacgtcccagaggacaaa
gacccccaagtccggaaactggccacccagttgctggtggacctggctgagggctgtcat
acccaccacttcaacagcctgctggacattgtggaaaaggtgatgtcccgctccctttct
ccacccgctgagctggaggagagagacgtggcggcgtactcggcctccgtggaggacgtg
aggaccgccgtcttggggctcctggtcattctgcagaccaagctgtactctttgcccgcc
agccacgcgatgcgcgtgtacgagacgctcgttggccacatccagctgcactacaagcac
gactacaccctgccgatcgccgccagcatccggatgcaggccttcgacttcctgctgctc
ctgagggccgactcgctgcaccgcctcggcctgcccagcaaggatggggccgtgaggttc
agcccttactgtgtctgcgatgccatggagccagagcggggcccagagaagaaggccagc
ggcgccctgtccaaccccaccgggccacctggccctacgcccacaggccccgcggtgcga
cttggctctctgccttactccctgctcttccgtgtgctgctgcagtgcttgaagcaggag
gcggactggaaggtgctgaagctcgtgctgggcaagctgcccgagtccctgcgctacaag
gtgctcatcttcacgtctccgtgcagcgtcgaccagctgtccgccgccctctgctccatg
ctttcaggtcccaggaccctggagcggctccgaggcaccccggaaggcttctccagaact
gacctgcatctggcggtggttcccgtgctgacagcgctcatctcgtaccacaactacttg
gacaaaaccagacagcgggagatggtgtactgcctggagcaaggcctgatctaccgctgt
gccagccagtgcgtggtggcgctggccatctgcagcgtagagatgccggacatcatcatc
aaggcgcttcccgtgctggtcgtgaagctcacacatatctcggccacggccagcatggcc
gttccacttctcgagttcctgtcaactctggccaggctgcctcacctctacaggaacttc
gcggcagagcagtacgcgagcgtcttcgccatctccctgccttacaccaatccctccaag
tttaatcagtacatcgtgtgcctggctcatcacgtcatagccatgtggttcattagatgc
cgcctgcccttccggaaggattttgttccctttatcactaagggcctgcgctccaacgtc
ctcctgtcctttgacgacacccccgagaaggacagcttcagagcgcgaagcaccagcctc
aacgagaggcccaagagtttgaggatagccagaacccccaaacaaggcttgactaactct
ccacccgtgaaagaacgcaaggagagctctgccacagaggccttccggtgccgcagcatc
agtgtgtcagagcatgtggtccgcagcaggatccagacgtccctcaccagcgccagtctg
gggtctgcggacgagaattcaatggcccaggctgatgacaacttgaaaaatctccatctg
gagctcacggagacgtgtctggacatgatggccagatacgtgttctccaacttcacagcg
gttcccaagaggtcccctgtgggagagttcctcctggctggtggcaggaccaaaacctgg
ctggtgggaaacaagcttgtcaccgtgacaacgagcgtggggaccgggacccggtcgctg
ctgggcctggactcaggagagctgccgggaggcccagagttgagcactgaccctggtgcg
cacgtgagacagaccaaggaggcgccggccaagctggagtcccaggctgggcagcaggtg
tgccgcggggcccgggaccgggtccgctccatgtccgggggccatggccttcgtgtgggt
gccctggacactccagcatcccacttcacaggtggccccacttcctcgggtgcacagatg
gcaccggccagcaaacccgagagggcgtcagcaggcacccagttcccagcacaggagaag
acgagcctggcggcctacgtgcccctcctgacccagggctgggcagagatcctggtccgg
aggcccacagggaacaccagctggctgatgagcctggaaaaccctctgagccccttctcc
tcggacatcaacaacatgccgctgcaggagctgtccaatgcgctcatggccgccgagcgc
ttcaaggaacgtcgggacacggccttgtacaagtcgctgtccgtgccggccgcgggctcc
gccaagccccccccgcccccgcgatccaacacggtggcctctctctcctcgctgtgccag
tccagttgccgagcacagctgcacaggggcgtttcctgggcagactcggcagtggttccg
gaggaggggagtctgagcgagtctcgtttgcccacggaacccacggagttggaggacttt
gaggcaacactaggcacagaccggcgtggcggccgcgctgaggcttacagcaggtcatcc
tcaagctctagccaagaggagaggttccccgcggaggaggccgctgccggagggatcccc
atcgagcgggccgtctcttccgagggcgcccggccttctgcggagctccccttccagccc
tcccagcccctcagcaagtccagctcctcgcccgagctgcagaccctacaggacatcctc
gggggccctggggacaagactgatgttggccggctgagccctgaggccaaggcccggtcc
cagtccgggatcctggacgggacaggtgcctcctggtcagctccaggtgaagagagccag
gtccagggccccgcgcagcccgagggtcccttgccttccagctgcccccgctcccccagt
ggcctgcggcccagaggctacaccatctctgattcggccccgtcacgcagaggcaagagg
gtagagagggatgccttcaagagcagaactggggcctccaatactgagaaggtgcccggc
atcaatcccagctttgtgttcctgcagctctaccattccccgttctttggtgacgaatcc
aacaagcccatccttctccccagtgagtccttcgagcggtcagtgcagcttcttgaccag
attccgtcctacgacacgcacaagatcgccgtcctttatgtgggagaaggccagagcaac
agtgagctcgccatcttgtccaacgagcacggctcgtacaggtacacggagttcctcact
ggcctgggcaaactcatcgagctcaaggactgtcagccagacaaggtgtacctgggtggc
ctggacgtgtgtggggaggacggccagttcacctactgctggcatgacgacatcatgcaa
gcggtcttccacattgccactctgatgcccaccaaagatgtggacaagcaccgctgtgac
aagaagcgccacctgggcaacgacttcgtgtccatcatctacaatgactcgggcgaggac
ttcaagctgggtaccatcagaggccagttcaactttgtccacgtgatcatcacacccctg
gactacgaatgcaatctggtgtccctgcagtgcaggaaagacatggagggtctcgtggac
accagcgtggccaagatcgtgtctgaccgcaacctgccttttgtggcccgtcagatggct
ctgcacgcaaacatggcctcacaggtgcatcacagccgctccaaccccaccgacatctac
ccttctaagtggattgccaggctccgccacatcaagcggctccgccaccggatccaagag
gaagcccagtactccagccccagcctgcccctgctgcagacgcacaccccgggccacggc
aaagcccctgctccagcgcccgcggagcccgtgccggcgtacgagacaggccagcggaag
cgcctcatctccgcggtggacgacttcacggagttcgtgtga

DBGET integrated database retrieval system