KEGG   Enhydra lutris kenyoni (northern sea otter): 111156293
Entry
111156293         CDS       T05871                                 

Definition
(RefSeq) 3-phosphoinositide-dependent protein kinase 1 isoform X1
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01524  Platinum drug resistance
elk03320  PPAR signaling pathway
elk04068  FoxO signaling pathway
elk04071  Sphingolipid signaling pathway
elk04140  Autophagy - animal
elk04150  mTOR signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04152  AMPK signaling pathway
elk04210  Apoptosis
elk04510  Focal adhesion
elk04660  T cell receptor signaling pathway
elk04664  Fc epsilon RI signaling pathway
elk04722  Neurotrophin signaling pathway
elk04910  Insulin signaling pathway
elk04919  Thyroid hormone signaling pathway
elk04931  Insulin resistance
elk04960  Aldosterone-regulated sodium reabsorption
elk05145  Toxoplasmosis
elk05205  Proteoglycans in cancer
elk05213  Endometrial cancer
elk05215  Prostate cancer
elk05223  Non-small cell lung cancer
elk05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111156293
   04071 Sphingolipid signaling pathway
    111156293
   04151 PI3K-Akt signaling pathway
    111156293
   04152 AMPK signaling pathway
    111156293
   04150 mTOR signaling pathway
    111156293
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111156293
  09143 Cell growth and death
   04210 Apoptosis
    111156293
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111156293
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    111156293
   04664 Fc epsilon RI signaling pathway
    111156293
  09152 Endocrine system
   04910 Insulin signaling pathway
    111156293
   03320 PPAR signaling pathway
    111156293
   04919 Thyroid hormone signaling pathway
    111156293
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    111156293
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111156293
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    111156293
   05231 Choline metabolism in cancer
    111156293
  09162 Cancer: specific types
   05215 Prostate cancer
    111156293
   05213 Endometrial cancer
    111156293
   05223 Non-small cell lung cancer
    111156293
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    111156293
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111156293
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111156293
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111156293
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:elk04131]
    111156293
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111156293
Protein kinases [BR:elk01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   111156293
Membrane trafficking [BR:elk04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    111156293
SSDB
Motif
Pfam: Pkinase PH_3 PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH Kdo YukC
Other DBs
NCBI-GeneID: 111156293
NCBI-ProteinID: XP_022372780
UniProt: A0A2Y9KUB7
LinkDB
Position
Unknown
AA seq 558 aa
MARTTSQLYDTVPIQSSVVLCACPSPSMVRTQTESGTAPGIPSGGSRQGPTMDSTAAAPR
PSASSLQHTAQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHI
IKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFD
ETCTRFYTAEMVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQAR
ANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLE
YDFPEKFFPKARDLVEKLLVLDATKRLGCEEMGGYGPLRAHPFFESITWENLQHQTPPKL
TAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSAADAGVPHTAGSNIEQYIHD
LDTNSFELDLEFSEDEKRLLLEKQASGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLL
TEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCKK
IQEVWRHRYQSHPDAAVQ
NT seq 1677 nt   +upstreamnt  +downstreamnt
atggccaggaccaccagccagctgtacgacaccgttcctattcagtccagcgtggtgtta
tgtgcttgcccgtccccatcaatggtgaggacccagactgagtccggcacggcccctggc
atcccgagcggcggcagcagacagggccctaccatggacagcaccgcggctgcgccccgc
ccgagcgcgagctccctgcagcacaccgcccagccgccgccacagcctcggaagaaacgg
cctgaagacttcaaatttgggaagattcttggtgaaggctctttttccacagttgtcctg
gcccgagaactggcaacctcaagggaatatgctattaaaattctagagaaacgtcacatt
atcaaagagaacaaggtcccgtatgtaaccagagagagagacgtgatgtcacgcctggat
cacccgttctttgttaaactttacttcacatttcaggatgatgaaaagctatactttggt
cttagttatgccaaaaatggagaactacttaaatacattcgcaaaattggctcattcgat
gagacatgcacccggttttacacggccgagatggtgtcagctctggagtacttgcatggc
aagggcatcattcacagggacctgaagccagaaaacattttgttgaatgaggacatgcac
atccagatcacggattttggaacagcgaaagtgctatccccagagagtaaacaagccagg
gccaactcgtttgtaggaacagcccagtatgtgtctccagagctgctcaccgagaagtcg
gcctgtaaaagttcagacctttgggctctcggatgtataatataccagcttgtggccgga
ctgccgccttttcgagcgggaaatgagtatcttatatttcagaagatcattaagttggaa
tacgacttccctgaaaaattcttccctaaggcaagagaccttgtggaaaaacttttggtt
ttagatgccacaaagcgattaggctgtgaggaaatgggaggctatggccccctgcgagct
catccgttcttcgagtccatcacgtgggagaacttgcagcatcagacgcctccgaagctc
accgcctacctgccggccatgtcggaggacgacgaggactgctatggaaactacgacaac
ctcctgagccagttcggctgcatgcaggtgtcctcatcgtcatcctcccactccctgtcc
gccgcggacgcgggcgtgccacacacggcgggcagcaacatcgagcagtatatccatgac
ctggacactaactcttttgagctggacttagagttctccgaagatgagaagaggttatta
ctggagaagcaggccagtggaaacccttggcatcagtttgtagaaaataacttaatacta
aagatgggtcccgtagataagcgaaagggcttgtttgcacgacgacgacagttactgctt
acagaagggccccacttgtattatgtggatcctgtcaacaaagtcctgaaaggggaaatt
ccgtggtcacaagagctccgaccagaggccaagaattttaaaaccttcttcgtgcacacg
ccaaacaggacgtattacctgatggacccgagtgggaatgctcacaaatggtgcaagaag
atccaggaggtgtggagacacagataccagagccacccggacgccgccgtgcagtga

DBGET integrated database retrieval system