KEGG   Enhydra lutris kenyoni (northern sea otter): 111156359
Entry
111156359         CDS       T05871                                 

Definition
(RefSeq) pro-epidermal growth factor isoform X1
  KO
K04357  epidermal growth factor
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk04010  MAPK signaling pathway
elk04012  ErbB signaling pathway
elk04014  Ras signaling pathway
elk04015  Rap1 signaling pathway
elk04020  Calcium signaling pathway
elk04066  HIF-1 signaling pathway
elk04068  FoxO signaling pathway
elk04072  Phospholipase D signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04510  Focal adhesion
elk04540  Gap junction
elk04630  JAK-STAT signaling pathway
elk04810  Regulation of actin cytoskeleton
elk05160  Hepatitis C
elk05165  Human papillomavirus infection
elk05200  Pathways in cancer
elk05210  Colorectal cancer
elk05212  Pancreatic cancer
elk05213  Endometrial cancer
elk05214  Glioma
elk05215  Prostate cancer
elk05218  Melanoma
elk05219  Bladder cancer
elk05223  Non-small cell lung cancer
elk05224  Breast cancer
elk05226  Gastric cancer
elk05231  Choline metabolism in cancer
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111156359
   04012 ErbB signaling pathway
    111156359
   04014 Ras signaling pathway
    111156359
   04015 Rap1 signaling pathway
    111156359
   04630 JAK-STAT signaling pathway
    111156359
   04066 HIF-1 signaling pathway
    111156359
   04068 FoxO signaling pathway
    111156359
   04020 Calcium signaling pathway
    111156359
   04072 Phospholipase D signaling pathway
    111156359
   04151 PI3K-Akt signaling pathway
    111156359
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111156359
   04540 Gap junction
    111156359
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111156359
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111156359
   05231 Choline metabolism in cancer
    111156359
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111156359
  09162 Cancer: specific types
   05210 Colorectal cancer
    111156359
   05212 Pancreatic cancer
    111156359
   05226 Gastric cancer
    111156359
   05214 Glioma
    111156359
   05218 Melanoma
    111156359
   05219 Bladder cancer
    111156359
   05215 Prostate cancer
    111156359
   05213 Endometrial cancer
    111156359
   05224 Breast cancer
    111156359
   05223 Non-small cell lung cancer
    111156359
  09172 Infectious disease: viral
   05160 Hepatitis C
    111156359
   05165 Human papillomavirus infection
    111156359
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111156359
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111156359
Cytokines and growth factors [BR:elk04052]
 Growth factors
  Growth factors (RTK binding)
   111156359
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition cEGF EGF_CA EGF DUF5050 EGF_3 S1FA
Other DBs
NCBI-GeneID: 111156359
NCBI-ProteinID: XP_022372865
UniProt: A0A2Y9KUK6
LinkDB
Position
Unknown
AA seq 1207 aa
MLLVLVILLPVVFKCSSASLSVLEHWNCPEASPPGKGNSTCVGPAPFLIFSHGNSIFRID
LEGTNHEQLVADAGVSVIMDFHYNTGRIYWVDLERKLLQRVFLNGTRQERVCNIEKNVSG
MAINWINEELIWSNQQEGMITITDMKGNNSRVLLSALNYPANVAIDPVERVIFWSSEVAG
SLHRADLNGLEEKILLETSGRVTAMSVDVLDKRLFWIQYNREGSNSYICSCNYDGGSVHF
SKHLTRHNLFAMSLFGDRIFYSTWKKKTIWIANKHTGKDMVRINLDPSFVPPVRIKVVHP
LLQPKAESDAWAPDQNLCKWRKGSCRGSMCGQGSKSHLCTCAEGYTLSQDGKYCEDVNEC
AFWNHGCTLGCENIPGSYYCTCPVGFILLPDGKRCHQLISCPSNISKCSYDCVLTSDGPV
CFCPEGSVLETDGKTCSGCSSPDNGGCSQLCLPLSPVSWECGCFPGYDLQLDKKSCVASG
PQPFLLFANSQDIRRLHFDGTEYGTLLSQQMGTVFALDHDPVENKIYFAHTALKWIERAN
MDGSQRERLIEETIDVPEGLAIDWIERKFYWTDRGKSLIEGSDLNGKHREIIIKEDLSQP
RGIAVHPMAKKLFWTDMGIKPRIESSSLQGVGRLVIASSDLVWPSGITIDYLTDKLYWCD
AKLSVIEMANLDGSKRQRLVQNDVGHPFAVAVFEDHVWLSDWTMPSVTRVNKRTGKNWVR
LRGSMLKPSSLVVVHPLAKPGATPCLHQNGGCEHICKERFGTAQCLCREGFVKAPDGKMC
LALNGHQIPAGSEADRGMPLDVSSRNRGSEESITESQSLLVAEIMVSDADDCGPVGCSSQ
AQCVSEGENATCQCLTGFTGDGKVCFDIDECETGITVCPPTSSQCVNTEGGYVCRCSEGY
QGDGIHCLDINECQLGRHTCGENATCTNTEGNYTCMCASSLSEPGRICTDSTPPSHLMED
GHHSVRNGFRECPPSYDGYCLHNGVCMYIEAVDRYACNCVFGYVGERCQHRDLRWELRHA
GQGRQRQVTVVAVCVVGLILLLLLGFWGAHCYRTKKLPSKNLKNPYEESSREGSSSRPTD
SQARMASCPQPWFVVIKEHQNLRNGSQPVTLKDGEAADVSQFSSLEPGSVQRTSWRNEPQ
MYVGTEQGCRTPLSSDRGSGPQTTEQSFPLPSCGAQPIALGIEKPHSLLSANPYDNKGPQ
IHHTKRS
NT seq 3624 nt   +upstreamnt  +downstreamnt
atgctgctcgtcctagtcattctgttgccggtagtttttaaatgtagttctgctagtctc
tcagtcctggaacactggaactgccctgaagcctctcccccaggaaagggaaattctact
tgtgtgggtcctgcacccttcttaattttctcccatggaaacagtatctttaggattgac
ctggaaggaactaatcatgagcaattggtggcagatgctggtgtatcagtgatcatggat
tttcactacaatacgggaagaatctattgggtagatctagaaagaaaacttctgcaaaga
gtttttctgaatgggacaaggcaagagagagtgtgcaatatagagaaaaatgtttcagga
atggcaataaattggataaatgaagaacttatttggtcaaatcaacaggaaggaatgatt
acaataacagatatgaaaggaaacaattctcgagttctcttaagcgccttaaactatcct
gcaaatgtagcaattgatccagtagaaagggttatattttggtcttcagaggtggctggc
agccttcacagagcagacctgaatggcctggaagagaaaattcttttagagacgtcagga
agagtaacagctatgtcagtggatgtgcttgataaacggcttttttggattcagtacaac
agagaaggaagcaattcttatatttgttcctgtaattatgacggaggttctgtccatttt
agcaaacaccttacacggcacaatttgtttgcaatgtccctttttggtgatcggatcttc
tattcaacatggaaaaagaagacaatttggatagctaacaaacacaccgggaaagatatg
gttagaatcaacctcgacccatcatttgtaccacctgttagaatcaaagtagttcatcca
ctcttacagcccaaggcagagagtgatgcttgggcacctgatcagaatctctgcaaatgg
aggaaaggtagctgcagaggcagcatgtgtggtcaaggctctaagtcccatttgtgcacg
tgtgcggagggatatactttaagccaagatggaaagtactgtgaagatgtcaatgaatgt
gccttttggaatcacggctgtactcttgggtgtgaaaacatccctggatcttattattgc
acatgccctgtaggatttattctgcttcctgatgggaaacggtgtcatcaattaatttcc
tgtccaagcaatatatccaagtgtagctatgactgtgttctgacatcagatggtcccgta
tgtttctgtcctgaaggctcagtgcttgagacagatggaaaaacatgtagtggctgttca
tcacctgataatggtgggtgtagccagctctgcctccctctcagcccagtctcctgggaa
tgtggttgctttcctgggtatgacctacaactggacaaaaaaagctgtgtggcatcagga
ccacagccatttttactgtttgccaattctcaagatattcgacgcttgcattttgatgga
acagagtatggaaccctgctcagccagcagatgggaacggtttttgcccttgatcacgac
cccgtggaaaataagatctatttcgcccatacagccctgaagtggatagagagagctaat
atggatggttcccagcgagaaaggcttattgaggaaactatagatgtgccagaaggtctt
gccatagattggattgagcgtaaattctactggacggacagggggaaatctctcattgaa
gggagtgatttaaatggaaaacaccgtgaaataatcatcaaggaggacctctctcagcca
cgaggaattgctgttcatccaatggccaagaaattattctggactgatatggggattaag
ccacgaattgaaagttcttcccttcaaggcgttggccgactggttatagctagttctgat
ctggtctggcccagtggaataacaattgattacttaactgacaaattgtattggtgtgat
gccaagctgtctgtgatcgaaatggccaatctggatggttcaaaacgccaaagacttgtc
cagaacgatgtagggcacccttttgctgtggctgtgtttgaggaccatgtgtggctctcg
gattggactatgccatcggtaacgagggtgaacaagaggacgggcaaaaactgggtacgt
ctccgaggcagcatgctgaagccctcatcactggttgtagtccatccattggcaaaacca
ggagcaacgccctgcttacatcaaaatggaggctgtgaacatatttgcaaagagaggttt
ggaactgctcagtgtttgtgtcgtgaaggttttgtgaaagccccagatggcaaaatgtgt
ctggctctgaatggccatcagataccggcaggtagtgaagcagatcgaggaatgccattg
gatgtctcatccaggaatagaggatctgaagagagcattacagaatctcagagtttgcta
gtggctgagatcatggtatcagacgctgatgactgtggtcctgtgggatgcagttcacag
gctcagtgtgtttccgagggagaaaatgctacatgtcaatgcttgacaggatttactggg
gatggaaaagtatgttttgatatagatgaatgtgagacgggcattactgtttgccctccc
acctcctctcagtgcgtcaatactgaaggtggctatgtctgccggtgctcagaaggctac
caaggcgatgggattcactgtcttgatattaacgaatgccaactgggcaggcacacctgt
ggggaaaatgccacctgtacaaatacggagggaaactacacctgcatgtgtgccagcagc
ctgtctgaacctgggcggatatgcactgactctactcccccttctcatctcatggaggac
ggccaccattctgtgagaaatggtttccgggaatgccccccatcctatgacggctactgc
ctccataatggtgtgtgtatgtacattgaagcagttgacagatacgcatgcaactgtgtc
ttcggctacgtcggggagcgctgtcagcaccgagacttgagatgggaactgcgccacgct
ggccaggggaggcagcggcaagtcaccgtggtggccgtctgtgtggtggggctcatcctg
ctgctgctgctggggttctggggggctcactgctacaggactaagaagctgccatcaaaa
aatttaaagaatccttatgaagagtcgagcagagaaggtagcagtagcaggcctacagac
agccaggctaggatggcctcctgtccccagccttggtttgtggtgataaaggaacaccaa
aatctcaggaatggaagtcaacccgtgaccctcaaggacggtgaggcagcagatgttagc
cagttctcctctctggagccaggctcagtgcaacggacatcatggagaaatgaacctcag
atgtatgtgggcacagagcaaggctgccgcactccactgtccagtgatagaggctctggt
ccccagacaacagagcagagctttcctctcccctcctgtggggcacagcccattgctttg
gggattgagaagccacattctctcctatcggctaacccatatgacaacaaagggccccag
atccaccacaccaaaagaagctga

DBGET integrated database retrieval system