KEGG   Enhydra lutris kenyoni (northern sea otter): 111156467
Entry
111156467         CDS       T05871                                 

Definition
(RefSeq) paxillin
  KO
K05760  paxillin
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04062  Chemokine signaling pathway
elk04370  VEGF signaling pathway
elk04510  Focal adhesion
elk04670  Leukocyte transendothelial migration
elk04810  Regulation of actin cytoskeleton
elk05100  Bacterial invasion of epithelial cells
elk05135  Yersinia infection
elk05163  Human cytomegalovirus infection
elk05165  Human papillomavirus infection
elk05170  Human immunodeficiency virus 1 infection
elk05203  Viral carcinogenesis
elk05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    111156467
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111156467
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111156467
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    111156467
   04062 Chemokine signaling pathway
    111156467
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    111156467
   05203 Viral carcinogenesis
    111156467
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    111156467
   05100 Bacterial invasion of epithelial cells
    111156467
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111156467
   05163 Human cytomegalovirus infection
    111156467
   05165 Human papillomavirus infection
    111156467
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:elk04990]
    111156467
Domain-containing proteins not elsewhere classified [BR:elk04990]
 LIM domain-containing proteins
  Paxillin family proteins
   111156467
SSDB
Motif
Pfam: Paxillin LIM
Other DBs
NCBI-GeneID: 111156467
NCBI-ProteinID: XP_022373098
UniProt: A0A2Y9KJ18
LinkDB
Position
Unknown
AA seq 557 aa
MDDLDALLADLESTTSHISKRPVFLSEETPYSYPTGNHTYQEIAVPPPVPPPPSSEALNG
TIVDPLDQWDPSASRFIHQQPQSPSPVCGSSAKTSSASVPQDGAGPPCSRAGEEEHVYSF
PNKQKSAEPSPTVMSSSLGSNLSELDRLLLELNAVQHNPPGFPADEANSSPPLPGALSPH
YGIPENNSPLGGKAGPLTKEKPKRNGGRGLEDVRPSVESLLDELESSVPSPVPAITVNQG
EMSSPQRVTASQQQTRISASSATRELDELMASLSDFKFMAQGKTGSSSPPGGPPKPGSQL
DSMLGSLQSDLNKLGVATVAKGVCGACKKPIAGQVVTAMGKTWHPEHFVCTHCQEEIGSR
NFFERDGQPYCEKDYHNLFSPRCYYCNGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEG
FHEKDGKAYCRKDYFDMFAPKCGGCARAILENYISALNTLWHPECFVCRECFTPFVNGSF
FEHDGQPYCEVHYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFK
EQNDKPYCQNCFLKLFC
NT seq 1674 nt   +upstreamnt  +downstreamnt
atggacgacctcgacgccctgctggctgacttggagtccaccacctcccacatctccaaa
cggcccgtgttcttgtcggaggagaccccctactcgtacccaactggaaaccacacatac
caggagattgccgtgccaccccctgtcccgccacccccgtccagtgaggccctcaatggc
acaatcgttgaccccttagaccagtgggatcccagtgcctcccgattcatccaccagcag
cctcagtccccgtcacccgtgtgtggctccagtgccaaaacttccagcgcttccgtgccc
caggacggcgccggccccccgtgttcccgagccggtgaggaagagcacgtctacagtttc
cccaacaagcagaagtcggccgagccttcacccactgtgatgagctcctccctgggcagt
aacctttccgaacttgaccgcctgctgctggaactgaatgcggtgcagcataaccccccg
ggcttccctgcagatgaggccaactcaagcccgccgctgcctggagctctgagcccccac
tatggcatcccggagaataacagcccactggggggcaaagctggacccctgacgaaagag
aagcccaagcggaatgggggccgcggcctggaggatgtgcggcccagtgtggagagtctc
ttggatgaactcgagagctccgtgcccagccccgtccctgccatcactgtgaaccagggc
gagatgagcagccctcagcgagtcaccgccagccagcagcagacacgcatctcagcctcc
tctgccaccagggagctggacgagctgatggcctccctttcggatttcaagttcatggcc
caggggaagacggggagcagctctccccctggggggcccccgaagcctgggagccagctg
gatagtatgctggggagcctgcagtctgacctgaacaaactgggggtcgccacggttgcc
aaaggggtctgcggggcctgcaagaagcccatcgctgggcaggtcgtgaccgccatggga
aagacgtggcacccggagcacttcgtctgcacccattgccaagaggagatcggatcccgg
aacttctttgagcgggatggacagccctactgtgaaaaggactatcataacctcttctct
ccgcgctgctactactgcaatggtcccatcctggataaagtggtgacagcccttgaccgg
acgtggcaccccgagcacttcttctgtgcccagtgtggagccttctttggtccagaaggg
ttccatgagaaagacggcaaggcctactgccggaaggattactttgacatgttcgcgccc
aagtgtggcggctgtgcccgggccattctggagaactacatctcggccctcaacactctc
tggcatcctgaatgctttgtgtgccgggagtgtttcacgcccttcgtcaatggcagcttc
tttgagcacgacgggcagccctactgtgaggtgcactaccatgagcggcgaggctcactc
tgctccggctgccagaagcccatcacaggccgctgtatcaccgccatggctaagaagttc
caccctgagcacttcgtctgtgctttctgcctcaagcagctcaacaagggcaccttcaag
gagcagaacgacaagccttactgtcagaactgcttcctcaagctcttctgctag

DBGET integrated database retrieval system