KEGG   Enhydra lutris kenyoni (northern sea otter): 111156657
Entry
111156657         CDS       T05871                                 

Definition
(RefSeq) homeobox protein Nkx-3.1
  KO
K09348  homeobox protein Nkx-3.1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk05200  Pathways in cancer
elk05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111156657
  09162 Cancer: specific types
   05215 Prostate cancer
    111156657
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111156657
Transcription factors [BR:elk03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, NK-2
    111156657
SSDB
Motif
Pfam: Homeodomain Homeobox_KN Homez UPF0561
Other DBs
NCBI-GeneID: 111156657
NCBI-ProteinID: XP_022373395
UniProt: A0A2Y9KW90
LinkDB
Position
Unknown
AA seq 229 aa
MLRAPAPWPGEAGAPTQSKPLTSFLIQDILRDGAERRGGHTSSPQPPRQPDPPRDQEPEQ
GRGGAGAPEDEWSAQSGAAQEAEAHAEGEPDRHLETYLLDCENSADSLPSLPQTSKQPQK
RSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLT
SDLGDLEKHTSLPALKEEGLPQASLISMHNSYPYYPYLYCLGGWNPPFW
NT seq 690 nt   +upstreamnt  +downstreamnt
atgctcagagctcccgcgccgtggccgggtgaggcgggggcgcccacccagtccaagccg
ctcacctccttcctcatccaggacatcctgcgggacggcgcggagaggcgcggcggccac
acgagcagcccgcagcccccgcgccagccggacccgccgcgagaccaggagccggagcaa
ggaagaggcggcgccggggcgcccgaggatgagtggagcgcccagtcgggcgccgcgcag
gaggccgaagcgcacgcagagggcgagccagatagacacttggagacttatctgttggac
tgtgaaaacagcgcagactccttaccaagccttccgcaaacctcgaaacagccacagaag
cgctcccgtgctgccttctcccacactcaggtcatcgagttagagaggaagttcagccac
cagaagtatctgtcagcccctgaaagggctcacctggccaagaacctcaagctcactgag
acccaagtgaaaatatggttccagaacagacgctataagaccaagagaaagcagctcacc
tcggacctgggagacctggagaagcacacctccctgccagccctgaaagaggagggctta
ccccaggcctccctcatctccatgcataacagctacccttactacccctacctgtactgc
ttggggggctggaacccacctttctggtaa

DBGET integrated database retrieval system