KEGG   Enhydra lutris kenyoni (northern sea otter): 111156883
Entry
111156883         CDS       T05871                                 

Definition
(RefSeq) glucocorticoid receptor isoform X1
  KO
K05771  glucocorticoid receptor
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111156883
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111156883
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:elk03310]
    111156883
Transcription factors [BR:elk03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    111156883
Nuclear receptors [BR:elk03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   111156883
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4 SCA7
Other DBs
NCBI-GeneID: 111156883
NCBI-ProteinID: XP_022373724
UniProt: A0A2Y9KR14
LinkDB
Position
Unknown
AA seq 782 aa
MDSKESLSPPSKEEISSSVLGRERGNVMDFYKTLRGGATVKVSASSPSLAAASQSDSKQQ
RLLVDFPKGPGSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDF
RLLEESIANLNRSTSVPENPKSSASAAVSAAPMEREFSKTLSDVSSEQQNLKGQTGSNGG
NVKLCTTDQSTFDIWRKKIQDLEFSSGSPENEASESPWKSDLLIDENCLLSPLAGEDDPF
LLEGNSNEDCKPLVLPDTKPKIKDNGELILSSPNSVPLPQVKTEKEDFIELCTPGVIKQE
KLGPVYCQGSFSGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASVSQQQDQKPIFNVIP
PIPVGSENWNRCKGSGDDNLASLGTLNFPGRSVFSNGYSSPGMRPDVSSPPSSSSAATGP
PPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGRQHNYLCAGRNDCIIDKIRRKNCPA
CRYRKCLQAGMNLEARKTKKKIKGIQQATPGASQETSENPANKTIVPATLPQLTPTLVSL
LEVIEPEVLYAGYDSSIPDTTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTL
LQYSWMFLMAFALGWRSYRQSSGNMLCFAPDLIINEQRMSLPCMYDQCKHMLFVSSELQR
LQVSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRF
YQLTKLLDSMHDVVENLLNFCFQTFLDKNMSIEFPEMLAEIITNQIPKYSSGNIKKLLFH
QK
NT seq 2349 nt   +upstreamnt  +downstreamnt
atggactccaaggaatcactaagtccccccagtaaagaagaaatctctagcagtgttctt
ggtcgggagaggggaaatgtgatggacttctataaaaccctaaggggaggagctactgtg
aaggtgtctgcatcttcaccctcactggctgctgcttctcagtcagactccaagcagcaa
agacttttggttgattttccaaaaggcccaggaagcaatgcacagcagccagatctgtca
aaggcagtttcactctcaatgggattgtatatgggagagacagaaacaaaagtgatggga
aatgacctgggattcccacagcagggccaaatcagcctttcctctggggaaacagacttt
cggcttctggaagaaagcatcgcaaacctcaacaggtccaccagtgttccagagaacccc
aagagctcagcgtccgctgctgtttccgctgcccccatggagagggagttttcaaaaact
ctctctgatgtgtcttcagaacagcaaaatttgaaaggccagactggctccaatgggggc
aatgtgaagttgtgtaccacagaccaaagcacctttgacatttggaggaaaaaaatacag
gatttggagttctcttctgggtccccagagaatgaggcgagtgagagcccttggaaatca
gacctcttgatagatgaaaactgtttgctttctcctttggcaggagaggatgatccattc
cttttggaaggaaactcgaatgaggactgtaagcctcttgttttaccggacactaaacct
aaaattaaggataatggagaactgatcttatcaagccccaacagtgtgccactgccccaa
gtgaaaacagaaaaagaagatttcattgaactctgcacccctggggtaattaagcaggag
aaactgggcccagtttactgtcagggaagcttttctggggcaaatataattggtaataaa
atgtctgccatttctgttcatggtgtgagtacctctgggggacagatgtaccactatgac
atgaatacagcatccgtttctcaacaacaggatcagaagcctatttttaatgtcattcca
ccaattcctgttggttcagaaaattggaataggtgcaaaggatctggagatgacaacttg
gcttccttggggactttgaacttcccgggtcgatcagttttttctaatggctattcaagc
cctggaatgagaccagatgtcagctctcctccatccagctcgtctgcggccacgggacca
cctcccaaactctgccttgtgtgctctgacgaagcctcggggtgtcattatggggtcttg
acttgcggaagctgcaaagtattcttcaaaagagcagtggaaggtagacagcacaactat
ctttgtgccggaagaaatgattgtatcattgataagattcgaagaaaaaactgtccagca
tgccgctatcgaaaatgtcttcaagctggaatgaacttggaagctcgaaaaacaaagaaa
aagataaaaggaattcagcaggccactccaggagcatcacaagaaacttcggaaaatcct
gctaacaaaacaatagttcctgcaacattaccacagctcacccctaccctggtgtccctg
ctggaggtcattgaacctgaggtgttatacgcaggatatgacagctctatcccagatacg
acatggcggatcatgaccacactcaacatgttaggtgggcggcaagtgattgcagcagtg
aaatgggccaaggcgataccaggattcaggaacttacacctggatgaccaaatgacccta
ctgcagtattcatggatgttcctcatggcatttgcccttggctggagatcatacagacaa
tcaagtggaaacatgctgtgttttgctcctgatctgatcattaatgagcagagaatgagc
ctcccctgcatgtatgaccaatgtaaacacatgctgtttgtttcctccgagttacagagg
ctgcaggtctcttacgaagagtatctctgtatgaagaccttactgcttctctcttcagtt
cctaaggaaggtttgaagagccaagagctatttgatgaaattcgaatgacctacatcaaa
gagctgggaaaagccattgtgaagagggaagggaactccagccagaactggcagcgcttt
taccaactgacaaagctcttggactccatgcacgacgtggttgaaaatctccttaacttt
tgcttccaaacatttttggataagaacatgagtattgaattcccagagatgttggctgaa
atcatcaccaatcagataccaaaatattcaagtggaaatatcaaaaaacttctatttcat
caaaaatga

DBGET integrated database retrieval system