KEGG   Enhydra lutris kenyoni (northern sea otter): 111156955
Entry
111156955         CDS       T05871                                 

Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04010  MAPK signaling pathway
elk04014  Ras signaling pathway
elk04015  Rap1 signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04390  Hippo signaling pathway
elk04810  Regulation of actin cytoskeleton
elk05200  Pathways in cancer
elk05218  Melanoma
elk05224  Breast cancer
elk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111156955
   04014 Ras signaling pathway
    111156955
   04015 Rap1 signaling pathway
    111156955
   04390 Hippo signaling pathway
    111156955
   04151 PI3K-Akt signaling pathway
    111156955
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111156955
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111156955
  09162 Cancer: specific types
   05226 Gastric cancer
    111156955
   05218 Melanoma
    111156955
   05224 Breast cancer
    111156955
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:elk04052]
    111156955
   00536 Glycosaminoglycan binding proteins [BR:elk00536]
    111156955
Cytokines and growth factors [BR:elk04052]
 Growth factors
  Growth factors (RTK binding)
   111156955
Glycosaminoglycan binding proteins [BR:elk00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   111156955
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 111156955
NCBI-ProteinID: XP_022373837
UniProt: A0A2Y9KIZ2
LinkDB
Position
Unknown
AA seq 155 aa
MAEGEITTFTALMEKFNLPVGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDLHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggggaaatcacaaccttcaccgccctgatggagaagtttaatctgcctgtg
gggaattacaagaagcccaaactcctctactgtagcaacgggggccacttcctgaggatc
cttccagatggcacagtggacggcacaagggacaggagcgacctgcacattcagctgcag
ctcagtgcggaaagcgtgggggaggtgtacataaagagtaccgagactggccagtacttg
gccatggacaccgatgggcttttgtacggctcacagacaccaaatgaggaatgtctgttc
ctggaaaggctggaagaaaaccattacaacacctacacatccaagaagcacgccgaaaag
aattggtttgtaggtctcaagaagaatggaagctgcaaacgcggtcctcggactcactat
ggccagaaagcaattctgtttctccccctgccagtctcctctgattaa

DBGET integrated database retrieval system