KEGG   Enhydra lutris kenyoni (northern sea otter): 111157042
Entry
111157042         CDS       T05871                                 

Definition
(RefSeq) epidermal growth factor receptor isoform X1
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk01522  Endocrine resistance
elk04010  MAPK signaling pathway
elk04012  ErbB signaling pathway
elk04014  Ras signaling pathway
elk04015  Rap1 signaling pathway
elk04020  Calcium signaling pathway
elk04066  HIF-1 signaling pathway
elk04068  FoxO signaling pathway
elk04072  Phospholipase D signaling pathway
elk04144  Endocytosis
elk04151  PI3K-Akt signaling pathway
elk04510  Focal adhesion
elk04520  Adherens junction
elk04540  Gap junction
elk04630  JAK-STAT signaling pathway
elk04810  Regulation of actin cytoskeleton
elk04912  GnRH signaling pathway
elk04915  Estrogen signaling pathway
elk04921  Oxytocin signaling pathway
elk04926  Relaxin signaling pathway
elk04928  Parathyroid hormone synthesis, secretion and action
elk04934  Cushing syndrome
elk05160  Hepatitis C
elk05163  Human cytomegalovirus infection
elk05165  Human papillomavirus infection
elk05171  Coronavirus disease - COVID-19
elk05200  Pathways in cancer
elk05205  Proteoglycans in cancer
elk05206  MicroRNAs in cancer
elk05210  Colorectal cancer
elk05212  Pancreatic cancer
elk05213  Endometrial cancer
elk05214  Glioma
elk05215  Prostate cancer
elk05218  Melanoma
elk05219  Bladder cancer
elk05223  Non-small cell lung cancer
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
elk05230  Central carbon metabolism in cancer
elk05231  Choline metabolism in cancer
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111157042
   04012 ErbB signaling pathway
    111157042
   04014 Ras signaling pathway
    111157042
   04015 Rap1 signaling pathway
    111157042
   04630 JAK-STAT signaling pathway
    111157042
   04066 HIF-1 signaling pathway
    111157042
   04068 FoxO signaling pathway
    111157042
   04020 Calcium signaling pathway
    111157042
   04072 Phospholipase D signaling pathway
    111157042
   04151 PI3K-Akt signaling pathway
    111157042
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111157042
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111157042
   04520 Adherens junction
    111157042
   04540 Gap junction
    111157042
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111157042
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    111157042
   04915 Estrogen signaling pathway
    111157042
   04921 Oxytocin signaling pathway
    111157042
   04926 Relaxin signaling pathway
    111157042
   04928 Parathyroid hormone synthesis, secretion and action
    111157042
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111157042
   05206 MicroRNAs in cancer
    111157042
   05205 Proteoglycans in cancer
    111157042
   05230 Central carbon metabolism in cancer
    111157042
   05231 Choline metabolism in cancer
    111157042
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111157042
  09162 Cancer: specific types
   05210 Colorectal cancer
    111157042
   05212 Pancreatic cancer
    111157042
   05225 Hepatocellular carcinoma
    111157042
   05226 Gastric cancer
    111157042
   05214 Glioma
    111157042
   05218 Melanoma
    111157042
   05219 Bladder cancer
    111157042
   05215 Prostate cancer
    111157042
   05213 Endometrial cancer
    111157042
   05224 Breast cancer
    111157042
   05223 Non-small cell lung cancer
    111157042
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111157042
  09172 Infectious disease: viral
   05160 Hepatitis C
    111157042
   05171 Coronavirus disease - COVID-19
    111157042
   05163 Human cytomegalovirus infection
    111157042
   05165 Human papillomavirus infection
    111157042
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111157042
   01522 Endocrine resistance
    111157042
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111157042
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:elk04147]
    111157042
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     111157042
Protein kinases [BR:elk01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   111157042
Exosome [BR:elk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   111157042
  Exosomal proteins of pancreatic cancer cells
   111157042
  Exosomal proteins of bladder cancer cells
   111157042
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Borrelia_P83 Kinase-like Kdo
Other DBs
NCBI-GeneID: 111157042
NCBI-ProteinID: XP_022373961
UniProt: A0A2Y9KK28
LinkDB
Position
Unknown
AA seq 1154 aa
MFNNCEVVLGNLEITYMQKNYDLSFLKTIQEVAGYVLIALNTVEKIPLENLQIIRGNVLY
ENTHALSVLSNYGTNKTGLQELPLRNLHEILQGAVRFSNNPVLCNVDSIKWQDIVDDSFV
SNMSMDFQNHAGNCQKCDPSCPNGSCWGPGKENCQKLTKIICAQQCSGRCRGRSPSDCCH
NQCAAGCTGPRESDCLVCRKFRDETTCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVK
KCPRNYVVTDHGSCVRACSSDSYEVEEDGVRKCKKCEGPCRKVCNGIGIGEFKDTLSINA
TNIKHFKNCTSISGDLHILPVAFRGDSFTRTLPLDPKELDILKTVKEITGFLLIQAWPEN
RTDLHAFENLEIIRGRTKQHGQFSLAVVGLDITSLGLRSLKEISDGDVIISGNKKLCYAN
TINWKKLFGTSSQKTKIINNKDEKGCKAMGHVCHPLCSSEGCWGPEPEDCVSCRNVSRGK
ECVEKCNVLEGEPREFVENSECIQCHPECLPQPMNVTCTGRGPDSCVKCAHYIDGPHCVK
TCPAGIMGENNTLVWKFADANRVCHLCHSNCTYGCDGPGLEGCTIEGHKIPSIAIGIVGG
LFLVVMVALGVGLFLRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFK
KIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPH
VCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRL
VHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTH
QSDVWSYGVTVWELMTFGSKPYDGIPASEISTILEKGERLPQPPICTIDVYMIMVKCWMI
DADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMEDVVDA
DEYLIPQQGFFHSPSTSRTPLLSSLSATSNNSTVACIDRNGSYPLKEDSFLQRYSSDPTG
TLTEDNIDDTFLPAPEYINQSIPKRPAGSVQNPVYHNQPLNPAPGRDAHYQNPHSNAVDN
PEYLNTIPPCVTSALGGPGLWAQKGNPQVSLDNPDYQQHFFPKEAKSNGVFKGPAAENAD
YLRVAPPSREFIGA
NT seq 3465 nt   +upstreamnt  +downstreamnt
atgttcaataactgtgaggtggtccttgggaatctggaaattacctacatgcaaaagaat
tatgacctttccttcttaaagaccatccaggaggttgccggctatgtcctcattgccctg
aacaccgtggagaagattcccttggaaaacctgcagatcatccgaggaaacgtgctctat
gaaaacactcatgccttgtccgtcttatccaactacggcacgaacaaaaccgggctgcag
gagcttcccctgagaaacttacacgaaatcctccaaggcgctgtgcgcttcagcaacaac
cctgtcctctgcaacgtggacagcatcaagtggcaggacatcgtggacgacagttttgta
agcaacatgtcgatggacttccagaaccatgcgggcaattgccaaaagtgtgatccgagc
tgtcccaatggaagttgttggggtccaggaaaagagaattgccagaaattgaccaaaatc
atctgtgcccagcagtgttcggggcgctgccgcggcaggtcccccagcgactgctgtcac
aaccagtgtgccgccggctgcacggggccccgcgagagtgactgtctggtgtgccgcaag
ttccgcgacgaaaccacgtgcaaggacacctgcccgccgctcatgctctacaacccgacc
acctaccagatggacgtcaacccagagggaaaatacagctttggcgccacctgcgtgaag
aagtgcccccgtaactacgtggtgaccgaccacggctcgtgtgtccgtgcctgcagctcc
gacagctacgaggtagaggaagatggagtccgcaagtgtaagaagtgtgaggggccttgc
cgcaaagtgtgtaatggaataggcattggcgaatttaaagacacactttccataaatgct
acaaatattaaacacttcaaaaattgcacgtcaatcagcggagatcttcatatcctgcct
gtagcgtttagaggtgactccttcacgcgtactctgcctctcgatccaaaggaactggac
attctaaaaactgtaaaggaaataacagggtttctgctgattcaggcctggcccgaaaac
aggactgacctccatgctttcgagaacctagaaatcatacgtggaagaacaaagcaacat
ggtcagttttctcttgcggtcgtcggcctggacataacgtccttgggcttacgctccctc
aaggagataagtgatggggatgtgatcatctcgggaaacaaaaaattgtgctatgcaaat
acaataaactggaaaaagctatttgggacttcaagtcagaaaaccaaaattataaacaac
aaagatgaaaaaggctgcaaggccatgggccacgtctgccatcctttgtgctcctcagag
ggctgctggggcccagagccggaagactgtgtgtcctgccgaaacgtcagccggggcaag
gaatgtgtggagaagtgcaatgttctggagggggagccaagggagtttgtggagaactcc
gagtgcatacagtgccacccggaatgcctgccccagcccatgaatgtaacctgcacggga
cggggaccggacagctgcgtcaagtgtgcgcactacatcgacggcccgcactgcgtcaag
acctgtccggctggcatcatgggagagaacaacaccctggtctggaagtttgcagatgcc
aatcgcgtgtgccacctgtgtcattccaactgtacctacggctgtgacgggccaggtctt
gaaggctgcacgatagaagggcacaagatcccatccattgccattgggattgtgggcggc
ctcttcttggtggtgatggtggccctcggggtgggcctctttttgcgccggcgccatatt
gtccggaagcgtacccttcgtagactcctgcaagaaagagagcttgttgagcctcttacg
cccagcggagaagctcccaaccaagctctcttgaggatcttaaaggaaacagaattcaaa
aagatcaaggtgctgggctctggagcatttggcacggtgtacaagggactctggatccca
gaaggtgagaaagttaaaattcctgtggccatcaaggaattaagagaagccacatctccg
aaagccaacaaggaaattcttgatgaagcctatgtgatggccagtgtggacaatcctcat
gtctgccgcctcctgggcatctgcctcacctccacggtccagctgatcacacagctcatg
ccctttggctgcctcctggactacgtccgcgagcacaaggacaacatcggctcccagtac
ctgctcaactggtgtgtgcagattgcaaagggcatgaactacctagaggaccggcgcttg
gtgcaccgcgacctggcagccagaaatgtcctggtgaagacaccacagcacgtcaagatc
acagattttgggctggccaagctgcttggtgccgaggagaaagaataccatgcagaagga
ggcaaggtgcctatcaagtggatggctttggaatcaattttacaccgaatttatacccac
caaagtgatgtgtggagctacggcgtcaccgtttgggagttgatgaccttcgggtccaag
ccttatgacggaatccccgccagcgagatctccaccatcctggaaaaaggagagcgcctc
ccgcagccacccatatgcaccatcgatgtctacatgatcatggtcaagtgctggatgata
gatgctgacagtcgtcccaaattccgtgaactgattattgaattctccaaaatggcccga
gacccccagcgctaccttgtcatccagggagatgagagaatgcacttgccgagccctaca
gactccaatttttaccgcgcactgatggacgaagaggacatggaggacgtggtggacgcc
gatgagtacctcatcccccagcagggcttcttccacagcccctccacgtcccggaccccc
ctcctgagctctctgagcgccaccagcaacaactccaccgtggcttgcattgacagaaac
gggagctatcccctcaaagaagacagcttcctgcagcggtacagctcagaccccacgggc
actttgactgaggacaacatagatgacacttttctcccagcacccgaatacataaaccag
tccatccccaagaggccggcgggttctgtgcagaatcctgtctatcacaatcagcctcta
aaccccgctcctggcagagacgctcactaccaaaacccccacagcaacgccgtggacaac
cctgagtatctcaacaccatccctccctgcgtcaccagcgcactcggcggccccggcctc
tgggcccagaaaggcaacccccaggtcagcctggacaaccccgactaccagcagcacttc
tttcccaaggaagccaagtccaacggcgtcttcaagggccctgcggccgaaaacgcagac
tacctgcgggtagccccgccgagcagggagtttattggagcatga

DBGET integrated database retrieval system