KEGG   Enhydra lutris kenyoni (northern sea otter): 111157077
Entry
111157077         CDS       T05871                                 

Definition
(RefSeq) insulin-like growth factor-binding protein 3 isoform X1
  KO
K10138  insulin-like growth factor-binding protein 3
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04115  p53 signaling pathway
elk04218  Cellular senescence
elk04935  Growth hormone synthesis, secretion and action
elk05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    111157077
   04218 Cellular senescence
    111157077
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    111157077
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    111157077
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:elk04131]
    111157077
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:elk04147]
    111157077
Membrane trafficking [BR:elk04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    111157077
Exosome [BR:elk04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   111157077
SSDB
Motif
Pfam: Thyroglobulin_1 IGFBP
Other DBs
NCBI-GeneID: 111157077
NCBI-ProteinID: XP_022374009
UniProt: A0A2Y9KRV2
LinkDB
Position
Unknown
AA seq 293 aa
MQRARPALWAAALTALALLRGPPAARAGAGSAGAGPVVRCEPCDARALAQCAPPPAASAC
SELVREPGCGCCLTCALHEGQPCGVYTERCGAGLRCQPQPGEQRPLQALLDGRGLCANAS
AAGRLRAYLLPAPSAPGNSSESEEDHSAGSVQGQAVPSTHRVPDARLQPLHTKIDVIKKG
HAKDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREVEDTLNRLKFLDMLSPRGIHIP
NCDRKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGFDARGKGDIHCYSMDSK
NT seq 882 nt   +upstreamnt  +downstreamnt
atgcagcgggcgcgccccgcgctctgggccgcggcgctgaccgcgctggcgctactccgc
gggccgccggccgcacgggccggcgcgggttcggcgggcgcgggccccgtggtgcgttgc
gagccgtgcgacgcgcgcgctctggcgcagtgcgcgccgccgcccgccgcgtccgcgtgc
tccgagctggtgagggagccgggttgcggttgctgcctgacgtgcgcgctgcacgagggc
cagccgtgcggcgtctacaccgagcgctgcggcgccggcctccgctgccagccgcagccc
ggtgagcagcgcccgttgcaggcgctgctggacggccgcgggctctgcgccaacgccagc
gccgccggccgcctgcgcgcctacctgctgccagcgccgtccgcgccaggaaacagcagt
gagtcggaggaagaccacagtgcagggagcgtgcagggccaggctgtccccagcacgcac
cgggtgcccgacgccaggctccagcccctgcacaccaagatagacgtcatcaagaaaggg
cacgccaaggacagccagcgctacaaggtggactacgagtcccagagcaccgacacccag
aacttctcctctgagtccaagcgggagacggaatacgggccgtgccgccgggaggtggaa
gacacgctaaaccgactcaagttcttggacatgcttagccccaggggcatccacatcccc
aactgtgaccggaagggtttctacaagaagaagcagtgccgcccttccaagggcaggaag
cgaggcttctgctggtgtgtggacaagtacgggcagccacttcccggcttcgacgcccgg
gggaaaggcgacattcactgctacagcatggacagcaagtag

DBGET integrated database retrieval system