KEGG   Enhydra lutris kenyoni (northern sea otter): 111157156
Entry
111157156         CDS       T05871                                 

Definition
(RefSeq) interleukin-3 receptor subunit alpha isoform X1
  KO
K04737  interleukin 3 receptor alpha
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04151  PI3K-Akt signaling pathway
elk04210  Apoptosis
elk04630  JAK-STAT signaling pathway
elk04640  Hematopoietic cell lineage
elk05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111157156
   04151 PI3K-Akt signaling pathway
    111157156
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111157156
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111157156
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    111157156
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111157156
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111157156
   04090 CD molecules [BR:elk04090]
    111157156
Cytokine receptors [BR:elk04050]
 Interleukin receptor families
  IL3 receptor family
   111157156
CD molecules [BR:elk04090]
 Proteins
  111157156
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind EpoR_lig-bind
Other DBs
NCBI-GeneID: 111157156
NCBI-ProteinID: XP_022374132
UniProt: A0A2Y9KJR4
LinkDB
Position
Unknown
AA seq 408 aa
MALLWLAVLLTSASSLPQSQEGRTEPQCVLRVCPAFCCFRETRRPDRYGSSGSDRYSPIK
NLRIEPVERRLTWDLHGNVSEIMCFINSKFITKAINNNRYCQFHILPSCEVKNFSVSLTK
GPPFSVGIQYPLQEGNPGAAAQGLDCRVHDVDFLTCSWEVGREAPRDIQYHLYWQDLRTQ
REYECPNYEMDNRGKLVRCHFNDVSRLPKLLQILVRGTSPGVRIPCSDRTVELSEIEILN
PPTITAMCNKSSLMMEWEACSHFNNRFEYELQLQKGSDPAYTEKLQEKFFELHNPRNYVA
RLRAKGFYRKSWSEWSAPQRFACDVGEDSQRPDWLLSALVLLATLLVLGLVIALCGRYSV
LQKLFPPIPHMRDPITDNLQSSKLVAWEGSRASREDCPVAEVQVLGET
NT seq 1227 nt   +upstreamnt  +downstreamnt
atggccttgctgtggctcgccgtgcttctgacgtctgcgtccagcctgccgcaatcacag
gaaggtaggaccgaaccccagtgcgttctgagggtgtgtccggcgttctgctgtttccgt
gaaactcgacgtccagatcggtacggatccagcggcagcgatcgctattcaccgattaag
aacctaaggatagagccggtggaaaggagattgacctgggacctccatggaaatgtttct
gaaattatgtgtttcataaattcgaaatttatcactaaggccatcaacaacaaccgttac
tgccagttccacatccttccctcgtgtgaagtgaaaaacttcagtgtctccttgaccaaa
ggcccgccattctcggtggggattcagtatcctctgcaagaaggaaaccctggggcggcc
gcacaaggtctggactgccgggtgcacgacgtggacttcctgacgtgcagctgggaggtg
ggcagggaggccccccgggacatccagtatcacctatactggcaggatctgaggacccag
agggagtacgagtgcccaaattacgaaatggataatcggggaaaactcgtccggtgtcat
ttcaatgatgtctccagattgccgaaactcctccagatcctggtgaggggcacaagccca
ggtgtcaggatcccctgctccgaccgtactgtcgaattatcagaaattgagatattaaat
ccacctactatcactgcaatgtgtaataaatcctctttgatgatggagtgggaagcgtgc
agccactttaataacagatttgagtatgaacttcagctacaaaagggcagtgatcccgcc
tacacggagaagctccaggaaaagttctttgagcttcacaatcccagaaactacgtggcg
agactaagggccaaaggtttctaccgcaaaagctggagcgagtggagtgccccccaacgc
ttcgcgtgcgatgtgggggaggactcgcagcggcccgactggctgctgtccgcgctggtc
ttgctggccacactgctggtcctggggctcgtgatcgcgctgtgtggaaggtactcagtg
ttgcagaagctctttcctcccatcccgcacatgagagaccccatcactgacaaccttcag
agcagcaagctggtggcctgggaaggcagcagggcaagccgggaggactgcccggtggcg
gaggtgcaggttttgggggagacatga

DBGET integrated database retrieval system