KEGG   Enhydra lutris kenyoni (northern sea otter): 111157502
Entry
111157502         CDS       T05871                                 

Definition
(RefSeq) G2 and S phase-expressed protein 1
  KO
K10129  G-2 and S-phase expressed protein 1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    111157502
SSDB
Motif
Pfam: GTSE1_N
Other DBs
NCBI-GeneID: 111157502
NCBI-ProteinID: XP_022374661
UniProt: A0A2Y9KLX8
LinkDB
Position
Unknown
AA seq 726 aa
MDVPGENDILLLADEKFDFDLSLSSSSANEDDEVFFGPVGHKERCVAASLELNHHIPEEP
LLSASESHFTWSPLTGEKFVEVYKEAHLLALQIESKSKNKAAQDVTAEDLWSQGVERFIQ
ESKLKISLFEKENEMKKSPKSLKRETYYLSDSPLRGAPLLGTQTPSGVALPRAPAQTQRP
PCSSHSSLPAEPSTVHPPHQSGTQKKVISKLVQPRAFSARGKNIPVATEQPMKRIAASPS
QMKILTEKEPRRDAVPDKSSVAQEPASLLAGGNHSVHGKRSLPVPNKLGLKKTLLKPPGC
VGGLSRKSSSGSVPAPISSVGASPAAGRARSSEPAGISTGASPPPSHRSQLGRMGPAGPR
QPLQAGPSGASCRQSRWAAAAEALADPAKAPPTVALAQASSPGQGGPGPNSGPTWSQPSP
LTAAGSARRRDSYLLCGTRAVPTPTSQFKIPKFATGEPADSATPRSCRARRPQSCTSVGR
VVVHSTPARRSSVAAPQSLGSCTRTPLSRKHVSALPTPASRRLSGLPVMTPKTVPRALAS
PLCVSARWLSSEPRKKSSVRAAPTQRNSSEATSGREDSSPEGPLSPPSAVPQALHFSPEE
RDLTFTKSIGTEVALGAAQPPGDAAASEALLVDLRLDQLAVTPQAESTAPLDVPLIDFCN
SPEVHVALGSERGPLIDLLLNTPDMDRNTASKAPQEVGQLIDLASPLIQLSPAADKENVD
SPLLKF
NT seq 2181 nt   +upstreamnt  +downstreamnt
atggacgtccccggggagaacgacattctcctgttggctgatgaaaaatttgacttcgat
ctttcattgtcttcttcaagtgcaaatgaagatgatgaggtcttctttggacccgttggg
cataaggaaagatgcgttgccgccagcttggaattaaaccatcacattcctgaagaacct
ctcttgtcagcctcagaaagtcacttcacctggagtcctctcactggggaaaaatttgtg
gaagtgtataaagaagcccacttactggccttacagatagaaagcaagagcaaaaacaag
gcagcccaagatgtcacagctgaagacctttggagccagggtgtggaaagatttatacag
gaatcaaaattaaaaataagcctatttgagaaagaaaatgaaatgaagaaaagccccaag
tcacttaagagggagacctattatctgtcagacagccccttgcggggtgcgccactcctg
ggaacccagaccccttctggcgtggccctcccaagggctcccgcccagacacagagacca
ccatgttcgtcccactcttctctgccagcggaaccaagtactgttcaccctccacaccag
tcagggactcagaaaaaggtcatcagcaaactggtgcagccccgggctttttctgcgaga
gggaagaacattcctgtggccacagagcagcctatgaaaaggatagcagccagtccttcc
cagatgaaaatcctcactgaaaaggaaccccgcagggacgcggtccctgacaagtccagt
gtggcccaggagcccgccagcctcctggctgggggaaaccactcggtccacggcaagcga
tcgctcccggttccgaacaagttgggactgaagaagaccctgttgaaaccacctggctgt
gttggcgggctctcaagaaagtcttcctcggggtccgttccagccccgatttccagcgtg
ggtgcttctccagcagctggcagagctagatccagcgagcctgcggggatttccacaggt
gcttccccgcctccgtcacaccgcagccagctgggcaggatgggacctgccgggccgcgg
cagcctctgcaggccggcccctcgggtgcctcctgcaggcagagcaggtgggccgcggct
gctgaggcgctggcggacccggccaaggcaccccccacagtggctctcgcccaagcctcg
tccccaggacagggaggccctgggccgaactccggccccacctggtcacagccctctccg
ctgacagccgctgggagcgcaagaaggcgtgactcctacctactctgtgggacgcgggcc
gtgcccacccctacaagtcaatttaagatccccaagtttgctactggtgagcccgcggac
agcgcgacaccgaggtcctgtcgagcacggaggccgcagtcctgcacatcggtagggagg
gtggttgtccatagcactcccgctagacgctcgtcagtggcggccccgcagagccttgga
agctgtacaaggacccccttgagtaggaagcacgtgtcagccctgcccacacctgccagc
cgccggctctccggccttccagtgatgacccctaaaaccgtgcccagagctctcgcttca
cctctgtgcgtgtccgcccggtggctttcttctgagccccggaaaaagtcttcggtgaga
gctgcaccaacgcagaggaacagcagcgaggctacctctgggcgcgaggactcgtcacct
gaggggcctttgtcccctccgtcggctgtgccacaggcacttcacttttctccagaggag
agggacttgacttttacaaaaagcatcggcacggaagtagcgctgggtgcagcccagccc
cctggagacgcggccgccagtgaggctcttctcgtggatctcagactggaccagctggcc
gtcaccccacaagctgaaagcacagcccccctcgacgtccctctcattgacttttgcaat
agtccggaggtgcacgtggctctgggatctgagcgtggaccactgattgacctgctgctc
aacactccagacatggacaggaacactgcgtccaaggccccccaggaggtgggacagctg
atcgacttggcttctcctctgatccagctgagccctgcggctgacaaggaaaacgtggat
tctccgcttctcaagttctga

DBGET integrated database retrieval system