KEGG   Enhydra lutris kenyoni (northern sea otter): 111157602
Entry
111157602         CDS       T05871                                 

Definition
(RefSeq) heme oxygenase 1
  KO
K00510  heme oxygenase 1 [EC:1.14.14.18]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk00860  Porphyrin and chlorophyll metabolism
elk01100  Metabolic pathways
elk04066  HIF-1 signaling pathway
elk04216  Ferroptosis
elk04978  Mineral absorption
elk05200  Pathways in cancer
elk05206  MicroRNAs in cancer
elk05225  Hepatocellular carcinoma
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    111157602
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    111157602
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    111157602
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    111157602
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111157602
   05206 MicroRNAs in cancer
    111157602
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    111157602
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111157602
Enzymes [BR:elk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.18  heme oxygenase (biliverdin-producing)
     111157602
SSDB
Motif
Pfam: Heme_oxygenase
Other DBs
NCBI-GeneID: 111157602
NCBI-ProteinID: XP_022374865
UniProt: A0A2Y9L0B3
LinkDB
Position
Unknown
AA seq 288 aa
MERPQPDSMPQDLSEALKEATKEVHVQAENAEFMKNFQKGLVTRKGFKLVMASLYHVYVA
LEEEIERNKDNPVFAPLYFPEELHRKAALERDMAFWYGTHWQEAIPYTQATRRYVRRLQE
VGRKEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGVDFFTFPNIASATKFKQ
LYRSRMNSLEMTPEVRQRVLEEAKTAFLLNIQLFEELQELLSRDAEDQSPSQAPGLRRRA
GSGAQDSTPTEPPRGKLQLSVLSQAPLFRWVLMLSFLVATVAMGLYVM
NT seq 867 nt   +upstreamnt  +downstreamnt
atggagcgcccgcagcccgacagcatgccccaggatttgtcagaggccctgaaggaagcc
accaaggaagtgcacgtccaggcagagaatgccgagttcatgaagaacttccagaagggc
ctggtgacccgaaaaggttttaagctggtgatggcctctctgtaccatgtctacgtggcc
ctggaggaggagatcgagcgcaacaaggacaacccggtcttcgccccactttacttccca
gaagagctgcaccgcaaggccgccctggagcgggacatggctttttggtacggaacccac
tggcaagaggccatcccctacacgcaggccacccggcgctacgtgcggcgactccaggag
gtagggcgcaaggagccagagctgctggtggcccacgcctacacccgctacctcggcgac
ctgtcagggggccaggtcctcaagaagatcgctcagaaggccctggacctgcccagctcc
ggcgagggcgtggacttcttcactttccccaacatcgctagcgccactaagttcaagcag
ctctaccgctcccgcatgaactctctggagatgacccccgaggtcaggcagagagtcctc
gaggaggccaagacggcattcctcctcaacatccagctgtttgaggagctgcaggagctg
ctgagccgggacgccgaggaccagagcccctcgcaggccccggggctgcgccggcgggca
ggcagcggggcacaagactcgactcccacagagcctcccagagggaagctccagctcagc
gttctctcccaggcaccgctcttccgatgggtccttatgctcagctttctggtggcgacg
gtggctatggggctttatgtcatgtga

DBGET integrated database retrieval system