KEGG   Enhydra lutris kenyoni (northern sea otter): 111157856
Entry
111157856         CDS       T05871                                 

Definition
(RefSeq) transcription factor Sp1 isoform X1
  KO
K04684  transcription factor Sp1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01522  Endocrine resistance
elk04137  Mitophagy - animal
elk04350  TGF-beta signaling pathway
elk04915  Estrogen signaling pathway
elk04927  Cortisol synthesis and secretion
elk04928  Parathyroid hormone synthesis, secretion and action
elk04934  Cushing syndrome
elk05016  Huntington disease
elk05017  Spinocerebellar ataxia
elk05163  Human cytomegalovirus infection
elk05200  Pathways in cancer
elk05202  Transcriptional misregulation in cancer
elk05224  Breast cancer
elk05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    111157856
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    111157856
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    111157856
   04928 Parathyroid hormone synthesis, secretion and action
    111157856
   04927 Cortisol synthesis and secretion
    111157856
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111157856
   05202 Transcriptional misregulation in cancer
    111157856
   05231 Choline metabolism in cancer
    111157856
  09162 Cancer: specific types
   05224 Breast cancer
    111157856
  09164 Neurodegenerative disease
   05016 Huntington disease
    111157856
   05017 Spinocerebellar ataxia
    111157856
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111157856
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    111157856
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111157856
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111157856
   03029 Mitochondrial biogenesis [BR:elk03029]
    111157856
Transcription factors [BR:elk03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    111157856
Mitochondrial biogenesis [BR:elk03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    111157856
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_8 zf-C2H2_6
Other DBs
NCBI-GeneID: 111157856
NCBI-ProteinID: XP_022375259
UniProt: A0A2Y9KVF3
LinkDB
Position
Unknown
AA seq 786 aa
MSDQDHSMDEMTAVVKIEKGVGGNNGGNGNGGGAFSQARSSSTGSSSSGGGGGQESQPSP
LALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPTS
KEQSGSSTNGSNGSESSKNRTVSGGQYVVAATSNLQNQQVLTGLPGVMPNIQYQVIPQFQ
TVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVPLQG
LANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAVTISSSGSQESGSQPAT
SGTAISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTTSGSAGTSSQGQTPQRVS
GLQGSDALNIQQNQTSGGSLQTSQQKEGEQNQQTQQQQQILIQPQLVQGGQALQALQAAP
LSGQTFTTQAISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQA
QTITLAPMQGVSLGQTSSSNTTLTPIASAASIPTGTVTVNAAQLSSMPGLQTINLSALGA
SGIQVHQLPSLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDPQPQAGRRT
RREACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCT
WSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVSL
SVGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVADLQSIN
ISGNGF
NT seq 2361 nt   +upstreamnt  +downstreamnt
atgagcgaccaagatcactccatggatgaaatgacagctgtggtgaagattgaaaaagga
gttggtggcaataatgggggcaatggtaatggtggtggtgccttttctcaggctcgaagc
agcagcacaggcagtagcagcagtggaggaggaggagggcaggaatcccagccatcccct
ctggctctgctggcagcaacttgcagcagaattgagtcacccaatgaaaacagcaacaac
tcccagggcccaagccagtcagggggcacaggtgagcttgacctcacagccacacagctc
tcacagggtgccaatggctggcagatcatctcttcctcctctggggctacccctacctca
aaggaacagagtggcagcagtaccaatggcagcaatggcagtgagtcttccaagaatcgc
acagtctctggtgggcagtatgttgtggctgccacttctaacttacagaaccagcaagtc
ctgacaggattacctggagtgatgcctaatattcagtatcaagtaatcccacagttccag
accgttgatgggcaacagctgcagttcgcagccactggagcccaagtgcagcaggatggt
tctggtcagatacagatcataccaggtgcaaaccaacagatcatcacaaatcgaggaagt
ggaggcaacatcattgctgctatgccaaacctactccagcaggctgtccccctccaaggc
ctggctaataatgtactctcaggacagactcagtatgtgaccaacgtaccagtggccctg
aatgggaatatcaccttgctacctgtcaacagcgtttctgcagctaccttgactcctagc
tctcaggcagtcactatcagcagctctgggtcccaggagagtggttcacagcccgccacc
tcagggactgccatcagttctgccagtttggtatcatcacaagccagttccagctccttt
ttcaccaatgccaatagctattcaacaactacaaccaccagcaacatgggaattatgaac
tttaccaccagcggatcagcagggaccagctctcaagggcagacaccccagagggtcagt
gggctacaggggtctgatgctctaaatatccagcagaaccagacatctggaggctctctg
caaacaagtcagcaaaaagagggagagcaaaaccagcagacgcagcaacagcagcaaatc
cttatccagcctcagctagttcaagggggacaggctctccaggcccttcaagcagcacca
ttgtcagggcagacctttacaacccaagctatctcccaggaaaccctccagaatctccag
cttcaggctgttccaaactctggccccatcatcatccggacaccaaccgtggggcccaat
ggacaggtcagttggcagactcttcagctgcagaatctccaagttcagaacccacaggcc
cagacaatcaccttggccccaatgcagggtgtttccttggggcagaccagcagcagcaat
accacccttacacccattgcctcagctgcctccatccctaccggcacagtcactgtgaat
gctgctcagctctcctccatgcctggcctccagaccattaacctcagtgcattgggtgct
tcagggatccaggtgcaccagcttccaagcctgcccttggctatagcaaatgccccaggt
gatcatggagctcagcttggcctccatggggctggtggtgatggaatacatgatgacaca
gcaggtggagaagaaggggaaaacagcccagatccacagccccaagctggtcggaggacc
cggcgggaagcatgcacctgcccctactgtaaagacagtgaaggaaggggctctggggat
cctggcaaaaagaaacagcacatttgccacatccaaggctgtggcaaagtatatggcaag
acctcacacctacgggcacacttgcgctggcatacaggcgagaggccattcatgtgtacc
tggtcatactgtgggaaacgctttacacgttcggatgagctacagagacacaaacgtaca
cacacaggagagaagaaatttgcctgccctgagtgtcccaagcgcttcatgaggagtgac
cacctgtcgaagcatatcaagacccaccagaataagaagggaggcccaggtgtatccctg
agcgtgggcactttgcccctggacagtggggcaggttcagaaggcagtggcactgccacc
ccttcagcccttattaccaccaatatggtagccatggaggccatctgtccagagggtatt
gcccgtcttgccaacagtggcatcaacgtcatgcaggtggcggatctgcagtctattaat
atcagtggcaatggcttctga

DBGET integrated database retrieval system