KEGG   Enhydra lutris kenyoni (northern sea otter): 111158041
Entry
111158041         CDS       T05871                                 

Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 6 isoform X1
  KO
K04433  mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04010  MAPK signaling pathway
elk04015  Rap1 signaling pathway
elk04218  Cellular senescence
elk04380  Osteoclast differentiation
elk04620  Toll-like receptor signaling pathway
elk04664  Fc epsilon RI signaling pathway
elk04668  TNF signaling pathway
elk04750  Inflammatory mediator regulation of TRP channels
elk04912  GnRH signaling pathway
elk04935  Growth hormone synthesis, secretion and action
elk05014  Amyotrophic lateral sclerosis
elk05022  Pathways of neurodegeneration - multiple diseases
elk05132  Salmonella infection
elk05135  Yersinia infection
elk05145  Toxoplasmosis
elk05161  Hepatitis B
elk05163  Human cytomegalovirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111158041
   04015 Rap1 signaling pathway
    111158041
   04668 TNF signaling pathway
    111158041
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    111158041
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111158041
   04664 Fc epsilon RI signaling pathway
    111158041
  09152 Endocrine system
   04912 GnRH signaling pathway
    111158041
   04935 Growth hormone synthesis, secretion and action
    111158041
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111158041
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111158041
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111158041
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    111158041
   05022 Pathways of neurodegeneration - multiple diseases
    111158041
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111158041
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111158041
   05135 Yersinia infection
    111158041
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111158041
   05161 Hepatitis B
    111158041
   05163 Human cytomegalovirus infection
    111158041
   05167 Kaposi sarcoma-associated herpesvirus infection
    111158041
   05169 Epstein-Barr virus infection
    111158041
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111158041
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     111158041
Protein kinases [BR:elk01001]
 Serine/threonine kinases: STE group
  STE7 family
   111158041
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal Choline_kinase DUF4344 APH
Other DBs
NCBI-GeneID: 111158041
NCBI-ProteinID: XP_022375544
UniProt: A0A2Y9KW52
LinkDB
Position
Unknown
AA seq 334 aa
MSQSKGRKRNPGLKIPKEAFEQPQPSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELG
RGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALF
REGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDV
KPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDI
WSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSEEFVDFTSQCLKKNSK
ERPTYPELMQHPFFTLHESKATDVASFVKLILGD
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgtctcagtcgaaaggcaggaagcgaaaccctggccttaaaattccaaaagaagcattt
gaacaacctcagcccagttccacgccacctcgagacttggactctaaagcttgcatttct
attggaaatcagaactttgaggtgaaggcagatgacctggagcccataatggagctgggg
cggggtgcgtacggggtggtggagaagatgcgacatgtgcccagcgggcagatcatggcg
gtgaagcggatccgggccacagtaaacagccaggagcagaagaggctactgatggatctg
gatatttccatgaggacagtggactgtccttttacagtcaccttttatggcgcactcttc
cgggagggtgatgtttggatctgcatggagctcatggatacgtcgctagataaattctac
aaacaagtgattgataaaggtcaaacaattccagaggacatcttagggaaaatagcagtt
tctattgtaaaagcgttagaacacttacacagtaagctgtctgtcattcatcgagacgtc
aaaccttccaatgtgctgatcaacgctcttggccaagtaaagatgtgcgattttggaatc
agtggctaccttgtagactctgtcgccaaaactattgacgcaggatgtaaaccatacatg
gcccctgaaaggataaacccagagctcaatcagaagggatacagtgtaaagtctgacatt
tggagtctgggcatcacaatgatcgagttggctatccttcggtttccctacgactcttgg
ggaactcccttccagcagctcaaacaggtggtagaggagccctcgccacagctcccggcg
gacaaattctcggaagagtttgttgactttacctcacagtgcttgaagaagaattccaaa
gaacggccaacatatccagaacttatgcaacatccgtttttcaccctacacgaatccaaa
gcaacagacgtggcatcttttgtaaaactgattcttggagactaa

DBGET integrated database retrieval system