KEGG   Enhydra lutris kenyoni (northern sea otter): 111158105
Entry
111158105         CDS       T05871                                 

Definition
(RefSeq) glial fibrillary acidic protein isoform X1
  KO
K05640  glial fibrillary acidic protein
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111158105
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:elk04131]
    111158105
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:elk04812]
    111158105
Membrane trafficking [BR:elk04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    111158105
Cytoskeleton proteins [BR:elk04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type III
     111158105
SSDB
Motif
Pfam: Filament Filament_head DUF1664 Spc7 GAS T6PP_N DUF573
Other DBs
NCBI-GeneID: 111158105
NCBI-ProteinID: XP_022375659
UniProt: A0A2Y9KWH6
LinkDB
Position
Unknown
AA seq 432 aa
MERRRVTSATRRSYASSLDVVGGGLVSGRRLGPGTRLSLARMPLPLPARVDFSLAGALNT
GFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAEL
RELRLRLDQLTASSARLEVERDNLAQDLGTLRQKLQDETNLRLDAENNLATYRQEADEAT
LARLDLERKIESLEEEIQFLRKIHEEEVQELQEQLARQQVHVELDVAKPDLTAALREIRT
QYEAMASSNMHEAEEWYRSKFADLNDAAARNAELLRQAKHEANDYRRQLQALTCDLESLR
GTNESLERQMREQEERHAREAASYQESLARLEEEGQSLKDEMARHLQEYQDLLNIKLALD
IEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEV
IKESKQEHKDVM
NT seq 1299 nt   +upstreamnt  +downstreamnt
atggagaggagacgggtcacctcggccactcgccgctcctatgcctcctccttggacgtg
gtagggggaggcctggtctctggccgccggctagggccaggcacccgcctctccctggcc
aggatgccacttccactcccggcccgggtggacttctccctggccggggctctcaatacc
ggcttcaaggagacccgagccagtgagcgggcggagatgatggagctcaacgaccgcttt
gccagctacattgagaaggtgcgcttcctggaacagcagaacaaggcgctggccgcagag
ctgaaccagctgcgggccaaggagcccaccaagctggccgacgtctaccaggctgagctg
cgagagctaaggctgaggctcgaccagctcacagccagcagcgcccggctcgaggtcgag
agagacaatctggcacaggacctgggcaccctgaggcagaagctccaagatgagaccaac
ctgaggctggatgctgagaacaacctggccacctatcgacaggaggcagatgaagccacc
ctagcgcgcctggatctggagaggaagattgagtctctagaggaggaaatccagtttttg
aggaagatccatgaggaggaggtgcaggagctccaggagcagctggcccggcagcaggtc
cacgtggagctggatgtggccaagccagacctcacagcggccctgcgagagatccgcacg
cagtatgaggccatggcttccagcaacatgcacgaggccgaggagtggtaccggtccaag
tttgccgacctgaatgacgccgctgcccgcaacgccgagctgctccgccaggccaagcac
gaggccaatgactaccgtcgccagctgcaggccctgacctgtgacctggagtccttgcgg
ggcacgaacgagtccctggagaggcagatgcgggagcaggaggagcgccacgcacgggag
gcagcaagttaccaggaatcgctggcccggctggaggaggaggggcagagcctcaaagat
gagatggcccgccatctgcaggagtaccaggacttgctaaacatcaagctggccctggac
atagagatcgccacgtacaggaagctgctggagggcgaggagaaccgtatcaccattccc
gtgcagaccttctccaacctgcagatccgagaaaccagcctggacaccaagtccgtgtca
gaaggccacctcaagaggaacatcgtggtaaagactgtggagatgcgggacggagaggtc
attaaggagtccaagcaggagcacaaggacgtgatgtga

DBGET integrated database retrieval system