KEGG   Enhydra lutris kenyoni (northern sea otter): 111158279
Entry
111158279         CDS       T05871                                 

Definition
(RefSeq) forkhead box protein O3
  KO
K09408  forkhead box protein O3
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk04062  Chemokine signaling pathway
elk04068  FoxO signaling pathway
elk04137  Mitophagy - animal
elk04151  PI3K-Akt signaling pathway
elk04152  AMPK signaling pathway
elk04211  Longevity regulating pathway
elk04213  Longevity regulating pathway - multiple species
elk04218  Cellular senescence
elk04722  Neurotrophin signaling pathway
elk04917  Prolactin signaling pathway
elk05213  Endometrial cancer
elk05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111158279
   04151 PI3K-Akt signaling pathway
    111158279
   04152 AMPK signaling pathway
    111158279
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    111158279
  09143 Cell growth and death
   04218 Cellular senescence
    111158279
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    111158279
  09152 Endocrine system
   04917 Prolactin signaling pathway
    111158279
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111158279
  09149 Aging
   04211 Longevity regulating pathway
    111158279
   04213 Longevity regulating pathway - multiple species
    111158279
 09160 Human Diseases
  09162 Cancer: specific types
   05213 Endometrial cancer
    111158279
   05223 Non-small cell lung cancer
    111158279
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111158279
Transcription factors [BR:elk03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    111158279
SSDB
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Other DBs
NCBI-GeneID: 111158279
NCBI-ProteinID: XP_022375917
UniProt: A0A2Y9KPK1
LinkDB
Position
Unknown
AA seq 671 aa
MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQGSPAKPSGETAADSMIPEE
EDDEDDEDGSGRAGSAMAIGSGGSGALGSGLLLEESARLLAPGGQDPGSGPAPAAGALSG
GTQTPLHPQQPLPPPQPGAAGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTLS
QIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGG
KSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPESADDSPSQLSKWPGSPTSRSSD
ELDAWTDFRSRTNSNASTVSGRLSPILASTELDDVQDDDAPLSPMIYSSTSLSPSVSKPC
TVELPRLTDMAGTMNLNDGLSDNLMDDLLDNITLPSSQPSPTGGLMQRSSSFPYTTKGSG
LASPTGSFNSTVFGPSSLNSLRQSPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLSHS
DVMMTQSDPLMSQASTAVSAQNSRRNVMLRNDPMMSFAAQPNQGSLVNQNLLHHQHQTQG
ALGGSRALSNSVSNMGLSDSSSLGSVKHQQQSPVSQSMQTLSDSLSGSSLYSASANLPVM
GHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLMSTQNVVGLNVGNFTGA
KQASSQSWVPG
NT seq 2016 nt   +upstreamnt  +downstreamnt
atggcagaggcaccggcctccccggccccgctgtctccgctcgaagtggagctggacccg
gagttcgagccccagagccggccgcgctcctgtacgtggcccctgcagaggccagagctc
caggggagcccggccaaaccctcgggtgagacggccgccgattccatgatccccgaagag
gaggacgatgaagacgacgaggacggcagcggtagggccggttcggccatggcgatcggc
agcggcgggagcggcgcgctaggctccgggctgctccttgaagagtcggcccggttgctg
gctcccggagggcaggaccccggctccgggccagcccccgcggcaggcgcgctgagcggg
gggacgcagacgccgctgcatcctcagcagccactgccgccgccgcagccgggggcggct
gggggctcggggcagccgaggaaatgctcgtcgcggcggaacgcctgggggaacctgtcc
tacgccgacctgatcactcgcgccatcgagagctcgccggacaagcggctcactctgtcc
cagatctacgagtggatggtgcgctgcgtgccctacttcaaggataagggtgacagcaac
agctctgcggggtggaagaactcgatccgacacaacctgtcattgcacagccggttcatg
cgggtccagaatgaggggaccggcaagagctcttggtggatcatcaaccctgatggggga
aagagtgggaaggcaccccggcggcgggctgtgtccatggacaacagcaacaagtatacc
aagagccgtggccgcgcagccaagaagaaggcggccctgcagaccgcccctgagtcagcc
gatgacagtccttcccagctctccaagtggccaggcagccccacgtcacgcagcagcgat
gagctggatgcgtggacggacttccgctcgcgcaccaattccaacgccagcactgtcagc
ggccgcctgtcccccatcttggcaagcacagagctggatgacgtccaggatgatgacgca
ccgctctcccccatgatctacagctcaactagcctctcaccctctgtaagtaagccatgc
actgtggagctaccacggctgaccgacatggcgggcaccatgaatctgaatgatgggctg
tctgacaacctcatggatgacctgctggataacatcacgctcccatcgtcccagccatcg
cccactggagggctcatgcagcgaagctctagcttcccatacaccaccaagggctccggc
ctggcttctccaactggctcctttaacagcacggtgtttggaccctcatctctgaattcc
ctgcgccagtctcccatgcagaccatccaagagaacaagccagctactttctcgtccatg
tcacactatggcaaccagacactccaggacctgctcacttcagactcactcagccacagc
gatgtcatgatgacccagtcggaccccttgatgtctcaggccagcaccgctgtgtctgcc
cagaactcccgccggaacgtgatgcttcgaaatgacccaatgatgtcctttgccgcccag
cctaaccaggggagtttagtcaatcagaacttgctccaccaccagcaccaaacccagggc
gctctcggtggtagccgtgccttgtcgaattctgtcagcaacatgggcttgagcgactcc
agcagccttgggtcagttaaacaccagcaacagtctcctgtcagccagtctatgcaaacc
ctctcggactctctctcaggctcctccttgtactctgcgagtgcaaaccttcccgtcatg
ggccatgagaagttccccagcgacttggacctggacatgttcaatgggagcttggaatgt
gacatggagtccattatccgtagcgaactcatggatgctgatgggttggattttaatttt
gattccctcatgtccacacagaatgttgttggtttgaacgtggggaacttcactggtgct
aagcaggcctcatctcagagctgggtgccaggctga

DBGET integrated database retrieval system