KEGG   Enhydra lutris kenyoni (northern sea otter): 111158354
Entry
111158354         CDS       T05871                                 

Definition
(RefSeq) son of sevenless homolog 1 isoform X1
  KO
K03099  son of sevenless
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk01522  Endocrine resistance
elk04010  MAPK signaling pathway
elk04012  ErbB signaling pathway
elk04014  Ras signaling pathway
elk04062  Chemokine signaling pathway
elk04068  FoxO signaling pathway
elk04072  Phospholipase D signaling pathway
elk04150  mTOR signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04510  Focal adhesion
elk04540  Gap junction
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk04660  T cell receptor signaling pathway
elk04662  B cell receptor signaling pathway
elk04664  Fc epsilon RI signaling pathway
elk04714  Thermogenesis
elk04722  Neurotrophin signaling pathway
elk04810  Regulation of actin cytoskeleton
elk04910  Insulin signaling pathway
elk04912  GnRH signaling pathway
elk04915  Estrogen signaling pathway
elk04917  Prolactin signaling pathway
elk04926  Relaxin signaling pathway
elk04935  Growth hormone synthesis, secretion and action
elk05034  Alcoholism
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05163  Human cytomegalovirus infection
elk05165  Human papillomavirus infection
elk05200  Pathways in cancer
elk05205  Proteoglycans in cancer
elk05206  MicroRNAs in cancer
elk05210  Colorectal cancer
elk05211  Renal cell carcinoma
elk05213  Endometrial cancer
elk05214  Glioma
elk05215  Prostate cancer
elk05220  Chronic myeloid leukemia
elk05221  Acute myeloid leukemia
elk05223  Non-small cell lung cancer
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
elk05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111158354
   04012 ErbB signaling pathway
    111158354
   04014 Ras signaling pathway
    111158354
   04630 JAK-STAT signaling pathway
    111158354
   04068 FoxO signaling pathway
    111158354
   04072 Phospholipase D signaling pathway
    111158354
   04151 PI3K-Akt signaling pathway
    111158354
   04150 mTOR signaling pathway
    111158354
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111158354
   04540 Gap junction
    111158354
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111158354
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111158354
   04660 T cell receptor signaling pathway
    111158354
   04662 B cell receptor signaling pathway
    111158354
   04664 Fc epsilon RI signaling pathway
    111158354
   04062 Chemokine signaling pathway
    111158354
  09152 Endocrine system
   04910 Insulin signaling pathway
    111158354
   04912 GnRH signaling pathway
    111158354
   04915 Estrogen signaling pathway
    111158354
   04917 Prolactin signaling pathway
    111158354
   04926 Relaxin signaling pathway
    111158354
   04935 Growth hormone synthesis, secretion and action
    111158354
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111158354
  09159 Environmental adaptation
   04714 Thermogenesis
    111158354
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111158354
   05206 MicroRNAs in cancer
    111158354
   05205 Proteoglycans in cancer
    111158354
   05231 Choline metabolism in cancer
    111158354
  09162 Cancer: specific types
   05210 Colorectal cancer
    111158354
   05225 Hepatocellular carcinoma
    111158354
   05226 Gastric cancer
    111158354
   05214 Glioma
    111158354
   05221 Acute myeloid leukemia
    111158354
   05220 Chronic myeloid leukemia
    111158354
   05211 Renal cell carcinoma
    111158354
   05215 Prostate cancer
    111158354
   05213 Endometrial cancer
    111158354
   05224 Breast cancer
    111158354
   05223 Non-small cell lung cancer
    111158354
  09165 Substance dependence
   05034 Alcoholism
    111158354
  09172 Infectious disease: viral
   05161 Hepatitis B
    111158354
   05160 Hepatitis C
    111158354
   05163 Human cytomegalovirus infection
    111158354
   05165 Human papillomavirus infection
    111158354
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111158354
   01522 Endocrine resistance
    111158354
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:elk04990]
    111158354
Domain-containing proteins not elsewhere classified [BR:elk04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   111158354
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_19 PH_10 IQ_SEC7_PH PH_13
Other DBs
NCBI-GeneID: 111158354
NCBI-ProteinID: XP_022376045
UniProt: A0A2Y9L3I6
LinkDB
Position
Unknown
AA seq 1333 aa
MQAQQLPYEFFSEENAPKWRGLLVPALKKVQGQVHPTLESSDDALQYVEELILQLLNMLC
QAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEVLGY
KIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFHQDV
EDINILSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLFSAN
DVENIFSRIVDIHELSVKLLGHIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYESYAR
DILRPGFHDRFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQL
EEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK
KMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRL
PGASNAEYRLKEKFFMRKVQINDKDDTSEYKHAFEIILKDENSVIFSAKSAEEKNNWMAA
LISLQYRSTLERMLDVTMLQEEKEEQMRLPSADVYRFAEPDSEENIIFEENMQPKAGIPI
IKAGTVIKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLIIERFEIPEPEPTEADR
IAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDADLLQRMEEFIGT
VRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPTVEWHISRPGHIETFDLLTLH
PIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIV
ETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQKKI
LEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKELINFSK
RRKVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIEPRN
PKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETESTASAP
NSPRTPLTPPPASGASSTTDVCSVFDSDHSSPFHSSSDTVFIQVSLPHGPRSASVSSISL
TKGTDEVPVPPPVPPRRRPESAPAESSPSKIMSKHLDSPPAIPPRQPTSKAYSPRYSISD
RTSISDPPESPPLLPPREPVRTPDVFSSSPLHLQPPPLGKKSDHGNAFFPNSPSPFTPPP
PQTPSPHGTRRHLPSPPLTQEVDLPSITGPPVPPRQSTSQHIPKLPPKTYKREHTHPSMH
RDGPPLLENAHSS
NT seq 4002 nt   +upstreamnt  +downstreamnt
atgcaggcgcagcagctgccgtacgagtttttcagcgaggagaacgcacccaagtggcgg
gggctgctggtgccggcgctgaaaaaggtccaggggcaagttcatccgactcttgagtct
agtgatgatgctcttcaatatgttgaagaattaattttgcagttattaaatatgctatgc
caagctcagccccgaagtgcttcagatgtagaggaacgtgttcaaaaaagtttccctcat
ccaattgataagtgggcaatagctgatgcccaatcggctattgaaaagaggaagcgaaga
aaccctttatctctcccagtagaaaaaattcatcctttactaaaggaggtcctaggttat
aaaattgaccaccaggtttctgtttacatagtagcagtattagaatacatttctgcagac
attttaaagctggtggggaattacgtacgaaatatacggcattatgaaattacaaaacag
gatattaaagtggcaatgtgtgctgataaggtattaatggacatgtttcatcaagatgta
gaagatataaatatattatctttaactgatgaagagccttccacctcaggagagcaaact
tactatgatttggtaaaagcatttatggcagaaattcgacagtacataagggaactaaat
ttaattataaaagtttttagagagccctttgtctccaattcaaaattgttttcagctaat
gatgtagaaaatatatttagtcgtatagtagatatacatgaacttagtgtaaagttactg
ggccatatagaagatactgtggaaatgactgatgaaggtagcccccatcccttagtagga
agctgctttgaagacttagcagaggaactggcatttgatccatacgaatcatacgctcga
gatatcttacggcctggttttcacgatcgtttcctcagtcagttatcgaagcctggagca
gcactctatttacagtcaataggcgaaggcttcaaagaagctgttcagtatgttttaccc
aggctacttctagcccctgtttaccactgtctgcattactttgaacttttgaagcagtta
gaagaaaagagtgaagatcaagaagacaaggaatgtttgaaacaagcaataacagctttg
cttaatgttcagagtggtatggaaaaaatatgttctaaaagtcttgcaaaacgaagactg
agtgaatctgcatgtcggttttatagtcagcaaatgaaggggaaacaactagcaatcaag
aaaatgaacgagattcaaaagaatattgatggttgggagggaaaagacattggacagtgt
tgcaatgaatttataatggaaggaactcttacacgtgtaggagccaaacatgagagacac
atatttctctttgatggcttaatgatttgctgtaaatcaaatcatgggcagccaagactt
cctggtgctagcaatgcagaatatcgtcttaaagaaaagtttttcatgagaaaggtacaa
attaatgacaaagatgacaccagtgagtacaagcatgcttttgaaataattttaaaagat
gaaaatagtgttatattttctgccaagtcagctgaagagaaaaacaattggatggcagcg
ttgatatctttacaataccggagtacgctggagaggatgcttgatgtgacgatgctgcag
gaagagaaggaggagcagatgaggctccctagtgctgatgtttatagatttgcagagcct
gactctgaagagaatataatatttgaagaaaacatgcagcccaaggctggaattccaatt
atcaaagcaggaactgttattaagcttatagagaggctcacataccatatgtatgcagat
cccaattttgttcggacatttcttacaacatacagatccttttgtaaacctcaagaacta
ctgagtcttataatagaaaggtttgaaattccagagcctgagcccacagaagctgatcgc
atagctatagagaatggagatcagcccttgagtgcggaactaaaaaggtttagaaaagaa
tacatacagcctgtacagctgcgagtattaaatgtatgtcggcattgggtagagcaccac
ttctatgattttgaaagggatgcagatcttttgcagcgaatggaagaatttattggaaca
gtgagaggtaaagcaatgaaaaaatgggttgaatccatcactaaaataatccaaaggaaa
aaaattgcaagagacaatggaccaggtcataatattacatttcagagttcacctcccaca
gttgagtggcatataagcaggcctgggcacatagagacttttgacctgctcaccttacac
ccaatagaaattgctcgacaactcactttacttgaatcagatctatatagagctgtacaa
ccatcagaattagttggaagtgtgtggacaaaagaagacaaagaaattaattctcctaat
ctcctaaaaatgatccggcataccacgaatctcactctgtggtttgagaaatgtattgta
gaaactgaaaacttagaagaaagagtagctgtggtgagtcgaatcattgagattctacaa
gtctttcaagagctgaacaacttcaatggtgtccttgaggttgtcagtgctatgaattcc
tcacctgtttacagactagatcacacatttgagcaaataccaagtcgccaaaagaaaatt
ttagaagaagctcatgaattaagtgaagatcactataagaaatatttggcaaaactcagg
tctattaatccaccatgtgtgcctttctttggaatttatctaactaatatcttgaaaaca
gaagaaggcaaccctgaggtcctaaaaaggcatggaaaagagcttataaactttagcaaa
aggaggaaagtagcagaaataacaggagagatccagcagtaccaaaatcagccttattgt
ttacgagtagaatcagatatcaaaaggttctttgaaaatttgaatccaatgggaaatagc
atggaaaaagaatttacagattatcttttcaacaaatccctagaaatagaaccacgaaat
cctaagcctcttccaagatttccaaaaaaatatagctatcccctaaaatctcctggtgtt
cgtccatcaaacccaagaccaggtaccatgagacatcccacacctctgcagcaggagcca
aggaaaattagttatagtaggatccctgaaagtgaaacagaaagtacagcatctgcacca
aattctccaagaacaccgttaacacctcctcctgcgtctggtgcttctagtaccaccgat
gtttgcagcgtttttgattccgatcattcgagcccttttcactcaagcagcgataccgtc
tttatccaagtttcactgccccatggcccaagatctgcttcagtatcatctataagttta
accaagggtactgatgaggtgcccgtcccccctcctgttcctccacgaagacggccggaa
tctgcccccgccgaatcttcgccatctaagattatgtctaagcatttggacagcccccca
gcaattcctcctaggcagcccacatcaaaagcctattcgccacgatactcaatatcagac
cggacctctatatcagaccctcctgagagccctcccttattaccaccacgagaacctgtg
aggacacctgatgttttctccagctcaccactacatctccagcctccccctttgggcaaa
aaaagcgatcatggcaatgccttcttcccaaatagcccttccccttttacaccacctcct
cctcaaacaccctctcctcatggcacaagaaggcacttgccatcgccaccattgacacaa
gaagtggaccttccttccatcaccgggccgcctgttcctccacgacaaagcacttctcag
catatccctaaactccctccaaaaacttacaaaagggagcacacacacccatccatgcac
agagatggaccaccactgttggagaatgcccattcctcctga

KEGG   Enhydra lutris kenyoni (northern sea otter): 111160889
Entry
111160889         CDS       T05871                                 

Definition
(RefSeq) son of sevenless homolog 2 isoform X1
  KO
K03099  son of sevenless
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk01522  Endocrine resistance
elk04010  MAPK signaling pathway
elk04012  ErbB signaling pathway
elk04014  Ras signaling pathway
elk04062  Chemokine signaling pathway
elk04068  FoxO signaling pathway
elk04072  Phospholipase D signaling pathway
elk04150  mTOR signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04510  Focal adhesion
elk04540  Gap junction
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk04660  T cell receptor signaling pathway
elk04662  B cell receptor signaling pathway
elk04664  Fc epsilon RI signaling pathway
elk04714  Thermogenesis
elk04722  Neurotrophin signaling pathway
elk04810  Regulation of actin cytoskeleton
elk04910  Insulin signaling pathway
elk04912  GnRH signaling pathway
elk04915  Estrogen signaling pathway
elk04917  Prolactin signaling pathway
elk04926  Relaxin signaling pathway
elk04935  Growth hormone synthesis, secretion and action
elk05034  Alcoholism
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05163  Human cytomegalovirus infection
elk05165  Human papillomavirus infection
elk05200  Pathways in cancer
elk05205  Proteoglycans in cancer
elk05206  MicroRNAs in cancer
elk05210  Colorectal cancer
elk05211  Renal cell carcinoma
elk05213  Endometrial cancer
elk05214  Glioma
elk05215  Prostate cancer
elk05220  Chronic myeloid leukemia
elk05221  Acute myeloid leukemia
elk05223  Non-small cell lung cancer
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
elk05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111160889
   04012 ErbB signaling pathway
    111160889
   04014 Ras signaling pathway
    111160889
   04630 JAK-STAT signaling pathway
    111160889
   04068 FoxO signaling pathway
    111160889
   04072 Phospholipase D signaling pathway
    111160889
   04151 PI3K-Akt signaling pathway
    111160889
   04150 mTOR signaling pathway
    111160889
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111160889
   04540 Gap junction
    111160889
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111160889
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111160889
   04660 T cell receptor signaling pathway
    111160889
   04662 B cell receptor signaling pathway
    111160889
   04664 Fc epsilon RI signaling pathway
    111160889
   04062 Chemokine signaling pathway
    111160889
  09152 Endocrine system
   04910 Insulin signaling pathway
    111160889
   04912 GnRH signaling pathway
    111160889
   04915 Estrogen signaling pathway
    111160889
   04917 Prolactin signaling pathway
    111160889
   04926 Relaxin signaling pathway
    111160889
   04935 Growth hormone synthesis, secretion and action
    111160889
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111160889
  09159 Environmental adaptation
   04714 Thermogenesis
    111160889
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111160889
   05206 MicroRNAs in cancer
    111160889
   05205 Proteoglycans in cancer
    111160889
   05231 Choline metabolism in cancer
    111160889
  09162 Cancer: specific types
   05210 Colorectal cancer
    111160889
   05225 Hepatocellular carcinoma
    111160889
   05226 Gastric cancer
    111160889
   05214 Glioma
    111160889
   05221 Acute myeloid leukemia
    111160889
   05220 Chronic myeloid leukemia
    111160889
   05211 Renal cell carcinoma
    111160889
   05215 Prostate cancer
    111160889
   05213 Endometrial cancer
    111160889
   05224 Breast cancer
    111160889
   05223 Non-small cell lung cancer
    111160889
  09165 Substance dependence
   05034 Alcoholism
    111160889
  09172 Infectious disease: viral
   05161 Hepatitis B
    111160889
   05160 Hepatitis C
    111160889
   05163 Human cytomegalovirus infection
    111160889
   05165 Human papillomavirus infection
    111160889
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111160889
   01522 Endocrine resistance
    111160889
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:elk04990]
    111160889
Domain-containing proteins not elsewhere classified [BR:elk04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   111160889
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH IQ_SEC7_PH PH_19 PH_13
Other DBs
NCBI-GeneID: 111160889
NCBI-ProteinID: XP_022379996
UniProt: A0A2Y9L266
LinkDB
Position
Unknown
AA seq 1332 aa
MQQAPQPYEFFSEENSPKWRGLLVSALRKVQEQVHPTLSANEESLYYIEELIFQLLNKLC
MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYQVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
IGLVSLCEDEPSSSGELNYYDLVRTEIAEERQYLRELNMIIKVFREAFLSDRKLFKPSDI
DRIFSNISDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDI
LSPKFNEHFSKLMARPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLKA
CSEDQEDRECLNQAITALMNLQGSMDRIYKQYSPRRRPGDPVCPFYNRQLRSKHLAIKKM
NEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKPNHSQSRLPG
YSSAEYRLKEKFVMRKIQICDKDDTCEYKNAFELVSKEENSIIFAAKSAEEKNNWMAALI
SLHYRSTLDRMLDSVLLKEENEQPLRLPSPDVYRFVVKDSEENIVFEDNLQSRSGIPIIK
GGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADKLA
IEKGEQPVSADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDLELLERLESFISSVR
GKAMKKWVESIAKIIKRKKQAQANGISHNITFESPPPPIEWHISRPGQFETFDLMTLHPI
EIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEA
ENFEERVAILSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRRILD
DAVELSQDHFKKYLVKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKKGKDLINFSKRR
KVAEITGEIQQYQNQPYCLRIEPEMRRFFENLNPMGSASEKEFTDYLFNKSLEIEPRNCK
QPPRFPRKSTFSLKSPGIRPNTGRHGSTSGTLRGHPTPLEREPCKMSFSRIAETDLESTV
SAPTSPNTPSTPPVSASSDLSVFLDVDLNSSCGSNSIFAPVLLPHSKSFFSSCGSLHKLS
EEPLIPPPLPPRKKFDHDASNSKGNMKSDDDPPAIPPRQPPPPKVKPRVPAPAGTFDGPL
HSPPPPPPRDPLPDTPPPVPLRPPEHFINCPFNLQPPPLGHLHRDPDWFRDVSTCPNSPN
TPPSTPSPRVPRRCYVLSSSHNNLAHPQAPPVPPRQNSSPHLPKLPPKTYKRELSHPPSY
RLPLLENAETPQ
NT seq 3999 nt   +upstreamnt  +downstreamnt
atgcagcaggcgccgcagccgtacgagttcttcagcgaagagaacagtccgaaatggcgg
ggactgctggtctcggccctgcggaaggttcaagagcaagtacatcccactctctcagct
aatgaagaatctctctattatattgaagagctgatttttcagctgcttaataaattatgc
atggctcaaccaaggactgttcaagatgtggaggaacgtgttcaaaagacctttcctcat
ccaattgataagtgggctattgctgatgcacaatctgccatagaaaaacgaaaacgaaga
aatcctctcctactgcctgtggacaaaatccatccttcattgaaggaagttttagggtac
aaagtggactatcaggtatccctgtatattgtggctgtactagagtatatctcagctgat
attttgaagttggctggtaattatgtttttaatatccgacattatgaaatatctcagcag
gacattaaagtgtcaatgtgtgcagataaggttttgatggacatgtttgatcaggatgat
ataggtttggtttctctctgtgaagatgaacctagttcttcaggtgaattaaactactat
gaccttgtcagaactgaaattgcagaagaaaggcagtatctacgggaactaaatatgatc
ataaaagtgtttcgagaagcctttctttctgacagaaagctgtttaaaccctctgatatt
gacaggattttcagtaacatttcagatatacatgaattaactgtgaaacttttaggtttg
attgaagacacagttgaaatgactgatgaaagcagtcctcatccgttagctggaagctgt
tttgaagatttggcagaagagcaagcatttgatccttatgaaacattatcacaggacatt
ctttctccaaaatttaatgaacatttcagtaagttgatggccagacctgcagtggctcta
cactttcagtccattgctgatggttttaaagaggcagttcgttatgtccttccacgcctt
atgctggtgcctgtttatcattgttggcactattttgaattattaaagcaattgaaagca
tgtagtgaagatcaggaagacagagaatgtttgaaccaagctattactgctcttatgaat
ctccaaggtagtatggaccgaatttacaagcagtattcacctagacgccgacctggggat
cctgtttgccctttttataatcgtcagttaagaagcaagcatctggctattaaaaaaatg
aatgaaattcagaaaaacatagatggatgggaaggcaaagatattggacaatgttgtaat
gaattcattatggaaggtcccttgacacgaattggtgctaaacatgaacgacatattttt
ctctttgatggcttaatgattagctgtaagcccaatcatagtcagtcacgccttccaggt
tatagtagtgcagagtacagattaaaagaaaaatttgtcatgaggaaaatacaaatatgt
gataaagacgatacttgtgagtacaaaaatgcttttgagttggtgtccaaagaagaaaac
agcataatatttgctgctaagtctgctgaagagaaaaataattggatggccgcacttatt
tctcttcactatcgtagtacactagatcgaatgctagattcagtgttactgaaagaagaa
aatgagcagccattgagattaccaagtcctgatgtgtatcgttttgtggtaaaagactct
gaggaaaacattgtttttgaagacaacctgcaaagtagaagtggaatccccattattaaa
ggaggaactgtagtgaaattaattgaaaggttaacatatcatatgtatgcagatcccaat
tttgttcgtacttttcttactacataccgttcattttgtaaaccacaggaattgctaagc
ttactgattgaacgatttgaaattccagagccagaacctactgaagcagataaattggcc
atagagaaaggcgaacagccagtcagtgcagaccttaaaaggtttcgcaaggaatatgtc
caaccagtacaacttaggatcttaaatgtgtttcggcactgggttgaacaccatttttat
gactttgaaagagatttggaattgcttgaaagactggaatccttcatttcaagtgtaaga
gggaaagctatgaagaaatgggtagagtcaattgctaagatcatcaagagaaagaaacaa
gctcaggcaaatggaataagccataatattacctttgaaagtccacctccaccaattgaa
tggcatatcagccgaccaggacagtttgaaacctttgatctcatgacacttcatccaata
gaaattgcacgtcaactgacacttttggaatctgatctctataggaaagtccaaccttct
gaactagtagggagtgtatggaccaaagaagataaagaaataaattctccaaatttatta
aaaatgattcgccataccacaaatctcactctatggtttgaaaagtgcattgtggaagca
gaaaattttgaggaacgggtggcaatactaagtagaattatagaaattcttcaggttttt
caagatttgaataatttcaatggtgtattggagatagtcagtgcagtaaattcagtgtcg
gtatacagactagaccatacttttgaggcattgcaggaaagaaaaaggagaattttggat
gacgctgtggaattaagtcaagatcactttaaaaaatacctagtaaaacttaagtcaatc
aatccaccttgtgtgcctttttttggaatatatttaacaaatattctgaaaactgaagaa
gggaataatgattttttaaaaaagaaagggaaagatttaatcaatttcagtaagaggagg
aaagtagctgaaattacgggagaaattcagcagtatcagaatcaaccttactgtttacgg
atagaaccagaaatgaggagattctttgaaaaccttaaccccatgggaagtgcttctgaa
aaggagtttacagattatttgttcaacaagtcactagaaattgaaccccgaaattgcaaa
cagccacctcgatttcctaggaaatcaactttctctttaaaatctcctggaatacggcct
aatacaggccgacatggctctacctcaggcactttacgaggtcatccaacaccattagaa
agagaaccatgtaaaatgagctttagtcggattgctgaaactgatcttgaatcaactgtg
tcagcaccaacctctccaaatacaccctctactccaccagtatctgcttcttcagacctt
agtgtgtttttagatgtggatctcaatagttcctgtggcagcaatagcatctttgctcca
gtcctcttgccacattcaaagtctttcttcagttcatgtggtagtttacacaaactaagt
gaagagccactgattcctccgcctcttcctcctcgaaaaaagtttgatcatgatgcttca
aattccaagggaaatatgaagtctgacgatgacccccctgctattccaccaagacagcct
cctcctccaaaggtaaaacccagagttcctgctcctgctggtacatttgatggacctctg
catagtccacctccaccgccgccaagagatcctcttcctgatacccctccaccagttccc
cttcggcctccagaacacttcataaactgtccgtttaatcttcagccacctccactagga
catcttcacagagatccagactggttcagagacgttagtacctgtccaaattcgccaaat
actcctcctagcacaccctctccgagagtaccacgtcgatgctacgtgctcagttctagt
cacaacaaccttgctcatcctcaagctccccctgttccaccaaggcagaattcaagcccc
cacctaccaaaactgccaccaaagacttataaacgggagctttcgcaccctccgtcatac
agactgcctttgctagaaaatgcggaaactcctcaatga

DBGET integrated database retrieval system