KEGG   Enhydra lutris kenyoni (northern sea otter): 111158436
Entry
111158436         CDS       T05871                                 

Definition
(RefSeq) interferon-induced, double-stranded RNA-activated protein kinase
  KO
K16195  eukaryotic translation initiation factor 2-alpha kinase 2 [EC:2.7.11.1]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04141  Protein processing in endoplasmic reticulum
elk04217  Necroptosis
elk05010  Alzheimer disease
elk05160  Hepatitis C
elk05162  Measles
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05171  Coronavirus disease - COVID-19
elk05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111158436
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111158436
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111158436
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111158436
  09172 Infectious disease: viral
   05160 Hepatitis C
    111158436
   05171 Coronavirus disease - COVID-19
    111158436
   05164 Influenza A
    111158436
   05162 Measles
    111158436
   05168 Herpes simplex virus 1 infection
    111158436
   05167 Kaposi sarcoma-associated herpesvirus infection
    111158436
   05169 Epstein-Barr virus infection
    111158436
   05165 Human papillomavirus infection
    111158436
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111158436
   01009 Protein phosphatases and associated proteins [BR:elk01009]
    111158436
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:elk03019]
    111158436
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111158436
Protein kinases [BR:elk01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   111158436
Protein phosphatases and associated proteins [BR:elk01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111158436
Messenger RNA biogenesis [BR:elk03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     111158436
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr dsrm DND1_DSRM Kdo Kinase-like YqfD
Other DBs
NCBI-GeneID: 111158436
NCBI-ProteinID: XP_022376160
UniProt: A0A2Y9L3U3
LinkDB
Position
Unknown
AA seq 541 aa
MANVRPPSFSIEELNIYCQKRNLVLKYYELSKKGPAHNLKFTFQVIINERKYSEAEGKSK
KEAKNAAAKLAIEKLNEESKAVSSLSLTTTDTSEGLGIGSIENFIGRLNRLAQKEKLSVN
YEQCELNESGPERFYYRCKIGQKEYAVGGGATKQEAKQMAAKFAYQQIEKTSMKEDSAAS
SDSWTTLSSDSGNSALVKNISASKSPLGNDSSPNATERNCNSNSVNTSSSPLSNVRSSEK
KVKRTLAPTFNSPVSKGNKHTVEERFANDFTEIMPIGLGGYGHVFKAKHKIDGKIYVIKR
VKYDKENKVEREVKALADLHHLNIVQYYNCWAGEDYHPEDSVNPSRPKIKCLLIQMEFCD
KGTLEAWIDDRRGKKPDKPLSLELYEQIAEGVKYIHSKELIHRDLKPSNIFLVNTKHIKI
GDFGLVTSLKDYANRTSSKGTLRYMSPEQISSPEYGKEVDIFAMGLILAELLYICPTLSE
TIQIFKALRDEKFPDVFDAREKFLLHKLLSHDPTKRPNASEILETLKEWKNVAVKKERNT
Y
NT seq 1626 nt   +upstreamnt  +downstreamnt
atggccaatgtgcgtccaccaagtttttctatagaagaacttaatatatactgtcagaag
cgcaacttggtacttaagtattatgaactgtctaagaaaggacctgcacataacttaaag
tttacatttcaagttatcataaatgagagaaaatattcagaagctgaaggtaaatcaaag
aaggaggccaaaaatgctgcagccaaattagctattgaaaaacttaacgaagaaagcaag
gcagttagttctttatcactgacaacaacagatacttcagaaggactaggaataggatcc
attgagaatttcataggccgtttgaataggcttgcccagaaggaaaaactatctgtaaat
tatgaacaatgtgaactgaacgaatctgggccagaaagattttattatagatgcaagatt
ggacagaaagaatatgctgttggcggaggtgctactaagcaggaggcaaaacagatggcc
gcgaaatttgcatatcagcagatagagaagacctccatgaaagaggactcagcagcatcc
agtgattcttggactactttgtctagtgactccggaaacagcgctttggtgaaaaacata
tctgcttctaaatcaccacttggaaatgattcctcaccaaatgcaacagaaagaaattgt
aacagcaacagtgtcaacacttcttcatctcctctgagcaatgtcagaagtagtgaaaag
aaggtgaaaagaactttggcacctacctttaactctcctgtgagcaaaggaaacaagcac
actgtggaagaaaggtttgctaatgattttacagaaataatgccaattggcttaggcgga
tatggtcatgttttcaaagcaaagcacaaaattgatgggaagatttatgttattaaacgt
gttaaatatgataaagagaataaggtagagcgtgaagtaaaagctttggcagatcttcat
cacctaaatattgttcagtactataattgctgggctggggaagattaccatcctgaggac
agcgtaaatccttcaagaccaaagattaaatgccttctcatccaaatggaattctgtgac
aaggggacattggaagcatggattgatgacagaagaggcaagaaaccagacaaacctttg
tctctggaattatatgaacaaatagcagaaggtgtaaagtatatacacagcaaagagcta
attcacagagaccttaagccaagtaacatatttttagtaaatacaaagcacataaagatt
ggagactttggacttgtgacatccttgaaagattatgcaaatcggacaagtagtaaagga
actcttcgatacatgagcccagagcagatttcttcaccagaatacggaaaagaagtggat
atctttgctatggggctaattctggcagaacttctttatatatgtcccactctttcagaa
acaatacagatttttaaagcgctaagggatgagaagttcccagatgtgtttgacgccaga
gaaaaatttcttctgcataaattactgtcacatgatcccacaaagcgacctaatgcttct
gaaatactggagactttgaaggagtggaaaaatgttgcagtgaaaaaggaacgaaacacg
tattag

DBGET integrated database retrieval system