KEGG   Enhydra lutris kenyoni (northern sea otter): 111158508
Entry
111158508         CDS       T05871                                 

Definition
(RefSeq) bcl-2-like protein 11 isoform X1
  KO
K16341  Bcl-2-like protein 11
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk04068  FoxO signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04210  Apoptosis
elk04215  Apoptosis - multiple species
elk04932  Non-alcoholic fatty liver disease
elk05169  Epstein-Barr virus infection
elk05200  Pathways in cancer
elk05206  MicroRNAs in cancer
elk05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111158508
   04151 PI3K-Akt signaling pathway
    111158508
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111158508
   04215 Apoptosis - multiple species
    111158508
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111158508
   05206 MicroRNAs in cancer
    111158508
  09162 Cancer: specific types
   05210 Colorectal cancer
    111158508
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111158508
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    111158508
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111158508
SSDB
Motif
Pfam: Bclx_interact Bim_N PMAIP1
Other DBs
NCBI-GeneID: 111158508
NCBI-ProteinID: XP_022376284
UniProt: A0A2Y9KY87
LinkDB
Position
Unknown
AA seq 315 aa
MFPAAAAGAARARGAARGAVGCRTARGGGRAATGRLCAAPGALKASPGLCLPRFFRADGQ
GAPGRRRTRAGRRGSRARTRRSEGKGRTKKDQMAKQPSDVSSECDREGGQLQPVERPSQL
RPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRS
SSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMEHFLSPCGVCRLESTFVGSIN
TETELTASRRQSQAVPADMRPEMWIAQELRRIGDEFNAYYPRRVFLNNYPAAEAHPQMII
LRLLRYIIRLVWRLQ
NT seq 948 nt   +upstreamnt  +downstreamnt
atgttcccggcggcggcggccggggcagcgcgggccagaggcgcggcgcgcggagccgtc
ggctgccggacggcgcgcggcggcgggcgggcggccactggccggctctgcgctgccccg
ggggctctgaaggcgagtcccgggctttgtctcccgcgcttctttcgtgctgacggtcag
ggagctccgggtcggcgaaggacgcgggcgggacgccgcgggtctcgggcccggacgcga
cggtcggaagggaaggggcggacaaaaaaagaccaaatggcaaagcaaccttcagatgta
agttctgagtgtgaccgagaaggtggacaattgcagcctgttgagaggccttctcagctc
aggcctggggcccctacctctctacagacagagcagcaaggtaatcctgaaggcgaaggg
gaccgctgcccccaaggcagccctcagggcccactggccccacctgccagccccggccct
tttgctaccagatccccgcttttcatctttgtgagaagatcctccctgctgtctcgatcc
tccagtgggtatttctcttttgacacagacaggagcccggcacccatgagttgtgacaaa
tcaacacaaaccccaagtcctccttgccaggccttcaaccattatctcagtgcaatggaa
catttcctctccccgtgtggggtttgcagacttgaatccacctttgtgggctccattaat
actgagacagaactcacagcttccaggaggcagtctcaggctgtacctgcagatatgcgc
ccggagatgtggattgcgcaggagttgcggcgtattggagacgagtttaatgcatattac
ccaaggagggtctttttgaataattacccagcagccgaagcccacccccaaatgattatc
ttacgactgttacgttacatcatccgcctggtgtggaggttgcagtga

DBGET integrated database retrieval system