KEGG   Enhydra lutris kenyoni (northern sea otter): 111158578
Entry
111158578         CDS       T05871                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: klotho
  KO
K14756  klotho [EC:3.2.1.31]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk00040  Pentose and glucuronate interconversions
elk00053  Ascorbate and aldarate metabolism
elk01100  Metabolic pathways
elk04211  Longevity regulating pathway
elk04928  Parathyroid hormone synthesis, secretion and action
elk04961  Endocrine and other factor-regulated calcium reabsorption
Module
elk_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:elk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    111158578
   00053 Ascorbate and aldarate metabolism
    111158578
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    111158578
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    111158578
  09149 Aging
   04211 Longevity regulating pathway
    111158578
Enzymes [BR:elk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.31  beta-glucuronidase
     111158578
Transporters [BR:elk02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   111158578
Exosome [BR:elk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111158578
SSDB
Motif
Pfam: Glyco_hydro_1
Other DBs
NCBI-GeneID: 111158578
NCBI-ProteinID: XP_022376408
UniProt: A0A2Y9KTC2
LinkDB
Position
Unknown
AA seq 1011 aa
MPARAPPRRLRPPPPLLSLLLLLALGGRRLNADPGDGAQTWARFAQPPAPEAAGLLPDTF
PDGFRWAVGSAAYQTEGGWRQHGKGASIWDTFTHHPPAPPGDPPVAGLPSGARPPSPPAT
GDVASDGYNNVFRDTEGLRELGVTHYRFSISWARVLPNGSAGAPNREGLRYYRRLLERLR
ELGVQPVVTLYHWDLPQRLQDAYGGWANRALADHFRDYAELCFRHFGGQVKYWITIDNPY
VVAWHGYATGRLAPGVRGSPRLGYLVAHNLLLAHAKIWHLYNTSFRPTQGGQVSIALSSH
WINPRRMTDHSIKECQKSLDFVLGWFAKPIFIDGDYPDSMKNNISSLLPDFTESEKKFIK
GTADFFALSFGPTLSFQLLDPHMKFRQLESPSLRQLLSWIDLEYNHPQIFIVENGWFVSG
TTKRDDAKYMYYLKKFIMETLKAIKLDGVDVIGYTAWSLMDGFEWHRGYSIRRGLFYVDF
LSQDKKLLPKSSALFYQKLIEKNGFPPLPENQPLEGTFPCDFAWGIVDNYIQVDTTLSQF
TDPNVYLWDVHHSKRLIKVDGVVTKRRKSYCVDFAAIRPQIALLQEMHVSHFHFSLDWAL
IQPLGNESQVNHTALHYYRCVVSELVRANITPVVALWRPTAPHHGLPPPLARHGAWENPR
TALAFAEYARLCFRDLGRHVKFWITMGEPYTRNMTYSAGHNLLKAHALAWRVYDEKFRAS
QKGKISIALQADWIEPACPFSPKDKEVAERVLEFDIGWLAEPIFGSGDYPRVMRDWLDRR
NNFLLPYFTEEEKRLIRGSFDFLAVSHYTTILVDWEKEDPVKYNDYLEVQEMTDITWLNS
PGQVAVVPWGLRKVLNWLKLKYGDLPMYIIANGIDDDPLAAQDRLRVYYMQNYVNEALKA
YILDGINLCGYFAYSFHDRSAPKFGLYHYAANQFEPKPSVKHYRKIIDNNGFPGPETLAR
FCPEEFTLCSECSFFHTRKSLLAFITFLLFAFIISLSLIFYYSKKGRRSYK
NT seq 3036 nt   +upstreamnt  +downstreamnt
atgccagcccgcgccccaccgcgccgcctgcggccgccgccaccgttgctgtcgctgctg
ctgctgctggccctgggaggccgccgcctgaacgccgacccgggcgacggggcgcagacc
tgggcccgcttcgctcagcctcccgcccccgaggctgccggcctcctccccgacaccttc
cccgacggcttccgctgggccgtgggcagcgccgcctaccagacagagggcggctggcgg
cagcacggcaagggcgcatccatctgggacacgttcacccaccaccccccggcgcccccg
ggagaccccccggtagccggcctgccgtcgggcgcccggcctccgtccccgcccgctacc
ggggacgtggccagcgacggctacaacaacgtcttccgcgacaccgaggggctgcgtgag
ctcggggtcacccactaccgattctccatctcgtgggcgcgggtgctccccaatggcagc
gcgggcgcccccaaccgcgaggggctgcgctactatcggcgcctgctagagcggctgcgg
gagctgggcgtgcagcctgtggtcaccctgtaccactgggacctgccccagcgcctgcag
gacgcttacggcggctgggccaaccgcgccctggccgaccacttcagggattacgccgag
ctctgcttccgccacttcggcggccaggtcaagtactggatcaccatcgacaacccctac
gtggtggcctggcacggctatgccaccgggcgcctggcccctggcgtccggggcagcccg
cggcttgggtacctggtggcgcacaacctcctcctggctcatgccaaaatctggcatctc
tacaatacttctttccgtccaactcagggaggccaggtatccattgcactaagctcccac
tggatcaatcctcgaagaatgaccgaccatagcatcaaagaatgtcaaaaatctcttgac
tttgtcctaggctggtttgccaaacccatattcattgatggtgactatcctgacagcatg
aagaataatatttcatctcttttgcctgattttactgaatccgagaaaaagttcatcaag
ggaacagctgacttttttgctctttcttttggaccaaccttgagttttcaattattggac
ccacacatgaagttccgccaattggaatctcccagcctgaggcaactcctttcttggatt
gaccttgaatataaccaccctcaaatatttattgtggaaaatggctggtttgtctcaggg
accaccaagagagatgatgctaaatatatgtattacctcaaaaaattcataatggaaacc
ttaaaagccatcaagctggatggggtagacgtcattggctacacagcgtggtcccttatg
gatggcttcgagtggcacagaggctacagcatcagacgtgggctcttctatgtcgacttt
ctaagccaggataagaaactgttgccaaaatcatcagccttgttctaccaaaagctgata
gagaaaaatggcttccctcctttacctgaaaatcaacccctagaagggacatttccctgt
gactttgcttggggaattgttgacaactacattcaagtggacaccaccctgtctcagttc
accgacccgaacgtttacctgtgggatgtccaccacagtaagcggctgattaaggtggac
ggggtggtgaccaagaggcggaagtcctactgcgtggacttcgccgccatccggccgcag
atagccttactccaggagatgcacgtctcgcattttcacttctcgctggactgggccctg
atccagccgctgggcaacgagtcgcaggtgaaccacacggcgctgcactactaccgctgc
gtggtcagcgagctggtgcgcgccaacatcaccccggtggtggcgctctggcggcccact
gccccgcaccacggcctgccgccgcccctggccaggcacggcgcctgggagaacccgcgc
accgccctggcattcgccgagtacgcccgcctgtgctttcgggatctcggccgccacgtc
aagttctggatcacgatgggcgagccttacacgcgcaacatgacctacagcgccgggcac
aacctgctgaaggcgcacgcgttggcttggcgcgtgtacgatgagaagttcagggcctct
cagaaggggaaaatatccatagccctgcaggccgattggatcgaacccgcctgccctttc
tccccaaaggacaaagaagtggccgagagagttttggaatttgacatcggctggctggcc
gagcccattttcggctctggggactacccacgtgtgatgagggactggctcgaccgaaga
aacaatttccttctcccgtatttcacggaggaagaaaaaaggctaatccggggctccttt
gactttctggctgtaagccattacaccaccatccttgtcgactgggaaaaagaagaccca
gtgaaatacaacgattacctggaagtgcaggaaatgaccgacatcacctggctcaactct
ccaggtcaggtggccgtggtgccctggggcttgcgcaaagttctcaactggctgaagctg
aagtacggagacctccccatgtatataatagccaacggcatagacgacgatccgctcgca
gcccaagacaggctgagggtgtattacatgcagaattatgtcaacgaagctctgaaagcc
tacatactggatggtatcaatctttgtggatactttgcttattcatttcatgatcgctca
gctccgaagtttggcctctatcattatgcagcaaatcagtttgagcccaaaccgtccgtg
aaacattacaggaaaattattgacaacaatggcttcccaggtcccgagactctggcaaga
ttttgtccagaggaattcaccctgtgctccgaatgcagcttttttcatacccgaaagtct
ttactggctttcatcactttcctactttttgcttttattatttctctttctctgattttc
tactactctaagaaaggcagaagaagttataaatag

DBGET integrated database retrieval system