KEGG   Enhydra lutris kenyoni (northern sea otter): 111158584
Entry
111158584         CDS       T05871                                 

Definition
(RefSeq) breast cancer type 2 susceptibility protein
  KO
K08775  breast cancer 2 susceptibility protein
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk03440  Homologous recombination
elk03460  Fanconi anemia pathway
elk05200  Pathways in cancer
elk05212  Pancreatic cancer
elk05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    111158584
   03460 Fanconi anemia pathway
    111158584
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111158584
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111158584
   05224 Breast cancer
    111158584
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:elk04121]
    111158584
   03036 Chromosome and associated proteins [BR:elk03036]
    111158584
   03400 DNA repair and recombination proteins [BR:elk03400]
    111158584
Ubiquitin system [BR:elk04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    111158584
Chromosome and associated proteins [BR:elk03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     111158584
DNA repair and recombination proteins [BR:elk03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     111158584
   FA (Fanconi anemia) pathway
    Downstream FA components
     111158584
SSDB
Motif
Pfam: BRCA-2_helical BRCA2 BRCA-2_OB3 BRCA-2_OB1 Tower
Other DBs
NCBI-GeneID: 111158584
NCBI-ProteinID: XP_022376414
UniProt: A0A2Y9KYL6
LinkDB
Position
Unknown
AA seq 3457 aa
MPIGCKERPTFFEIFKTRCNEADLGPISLNWFEELSLEAPSYNSEPTEESGYKISYEPNL
FKTPQRKPYHQLASTPIIFQEQGLIVPMYQQSPLKELGRYRLDSGKDITNSKHKSCCTMK
SKMDQTNDVTSPPLNSCLSESPFLRCTHVTPQREKSVVCGSLFHTPKLMKGQTPKRISES
LGAEVDPDMSWSSSLATPPTLSSTVLIVRDEEASAAVFPNDTTAIFKSCFPKHDESLKKN
DRCIPSGPDKENKNQREAKSQGLGKMLGNSFGKVNSCKDHFGKSTPNVLEDEVREIVADV
SEEDSFSLCVPKYKMRNLPKIKTSKTRKNIFNETKTNECEETKKQMKENKHSFLSEMEPN
DSDPLDWSVTNPKPFGNGNEKISKEFVPSSASEWSHLTLSGLSGTQMEKTPLLHSSSCDQ
NNSERDFTITEKESTNFITLGNSLPQISSVPKYSETTLNKETVVNKIDEEQCLGSHEDSI
LSGKQTISETTVIHSPLHGIRKSIFRIRESSEEMSSAVFSNHMTDLNSKEEIDTPESALE
KYTICSQKEDSLGSIDNGSWPATIRHTSGALKTSGLISTLKKKTKKFIYVINDEASYQGL
KTQKDQELGLTNHSDQSEANAFEGPLTFTNADSGLLHSSSVKKNCPQNDSEEPALSLTSS
FGTILRKVSNNGTSSVNNKTVPRDLDYKEAKINKEKLQSFITTETDCLSSLPEKHCEDDA
KSQRVSDIKEKVLPAVSYPPVPHSEVEGCGIHFQSPESFSSDHDNTSLTPSSRDPPSNPV
MTCRGKESYKMSEKLKCKNHKGGFELIKNIPMEKNQEMHVLNANSKNTEVLSTEKYVIVA
SPSMKVQFNQNANLTTIQKDQKETTLISKIAVNPNSEELFPDDENNFVLEITNESNIPVL
ENIKELHDADLYCVREPVLKNSTMMVYTDMDDKQAAKVSIMKDFDSSNIDDLTEKNGNSI
KQQLKMTLDQDSKSDITLEVVRKSNGNNDYMNNWTRQSDPVSNHSFGNGFRTASNKEIKL
SEHNIKKSKMLFKDIEEHYPTNLACIEIVNTSSLESQKKLSKPLALDPQSINSMSVFVQS
SAYVSDSESGHIAPLTSSLKQDFNSNHNLTPSQKAEITELSTILEESGSQFEFTQFRKPS
HIIEKNPFEMPENQLTILNRTSEECRNTDLHLTVNAPSIIQVDSSKKFEGVLGGNQRFAC
LSRTNCNRSACGCLADKNEVKFRGFYSARGTKLNVGSEALQKAKQLFRDLENIIEEPSVE
VDTRSFSSGKCNDSAVSMIQIEDCNNDKNFNEKNNKSQLILQNNIEMTAGIFVEENSEGY
KGNTENEDNQRTDASGNTHNLESVGNDSNKNDTVYIHEEENSLLCIHQHNIDQKLSSQLM
KEGNTQIKEGLSDLTCLEVAKAEETFRVNTSNKQQLTANTKGQNIKDFDIFDLSFQTASR
KNIRVSKESLNKVINLFDQKWTEEELNNFSDSLNSELLSGVDINKIDISSYEKTENSERK
NKIMKESDLIGTENKLLTLQQRPESEIKKIKEPTMLGFHTASGKKIEIAKESLDKVKNLF
DEKEQGDSGITNFSHQGAKMSKDREKCEDGLELACETIELTAPKYEEMQNSLKEKKLVSS
EIVVAPRLLSGNLNKQTENLKISDQASLKVKVHENTEKETAKKHTIYTNQFTYSATENSP
LAFYTGHGRKISVSETSLFEAKKRLREGELDDKPEKINTATVICLKEYLDDYVENPSCGN
SSSSTISENDKNPPSEKQGLTYLSNSTVSNRYSYHLDFCHPSEVYKKSEYLLKNKVDNSG
TEPVVKNVRENTIFSEITSTVREADTDPQIINKDICVQKLVTNSLCKNENTAIKVAISDS
NNFNSIQKLNSDSNTAVPAYSTASSKRVFVAHQTKTTEGFTDNCSMIIKQNPKSKSDTCH
MRIVAGYPNTLDNSEDIIFPDSLDDAEHSSSSRKVFAGIQSEHTLQLNQSISGLEKVSEI
PTCQNNSKTSDTCKLNTGKLPKSVSCTNACGIFSTASGKSVQVSDAALQKARQVFSKIED
SAKQLFPKVSFKNSEHSDKFTNEENAMLQTSQNLLLSTFSGFSTASGKQVPVSESALCKV
KGMLEEFDLIRTECGLQHSSTSRQDASKIPPPSCIDKRTPEQCGNSKLEMAYNKEFKLSS
HCNIERGSSENHRSIQVSPCQSQLKQDKQQLLLGSKVSLVENIHLLGKEQALPKNTKTEI
GKTETFPNLPVKTNIEICSTYSRDPENYLETETVEIARAFMEDGELTDSELLSHAKHSLF
TCQSTEEMVLLNSRIGKRRGDALVSVGEPPIKRNLLNEFDRIIKNQEKSLKASKSTPDGI
LKDRSLFMHHISLEPITSGPFSTTKERQEMQNPNFTVPHQEFLSKSRFYEHPALEKSSSN
LSVSGPPFCTVPATRNEKRRHLNTPGKPVKVFVPPFKTKSRFHRDEQCISKNTNLEENKQ
NPENIDEHGPGESETNINDGGIHQLKKNNPSQAATIIFTKCEKEPLDLITNLQNARDIQD
MRIKKKQRQHIFPQPGSLYLAKTSTVPSISLRGAVEGRVPSPCSHKQLYMYGVSKHCVKI
NSKNAESFQFHTEDYFGKEGLWSGEGIQLADGGWLIPSNDGKAGKEEFYRALCDTPGVDP
NLISRVWVYNHYRWIIWKLAALEFAFPKEFANRCLSPERVLLQLKYRYDVEIDRSRRSAL
KKIMERDDTAAKTLVLCISEIISSSVDISETSSSKTNSVGTKKVGIVELTDGWYAVKAQL
DPPLSALVKNGKLTVGQKIITHGAELVGSPDACTPLEAPESLMLKIAANSTRRARWYAKL
GFSPDPRPFPLSLSSLFSDGGNVGCVDVVVQRAYPIQWMERTPSGLCIFRNEREEEKEAT
KYAEAQQKKLEVLFNKIQGEFEKHDENISKQCRPSCALTRQQVCALQDGAELYEAVTNAP
DPAYLEGYFSEEQLRALNNHRQMLNDKKQAQIQLEFRKAMESAEQGEQILSRNVTTVWKL
RIISYGKKEKDSVTLSIWRPSSDLYSLLTEGKRYRIYHLATSQSKSKSEKVNIQLTATKK
TQYQQLQASDEILCQIYQPREPLYFNKLLSPDFQPPCSEVDLVGFVISVVKKIGLAPLVY
LSDECHNLLAIKFWIDLNEDIIKPHTLIAASNLQWRPEAKSGIPTLFAGDFSRFSASPKE
GHFQEIFHKMKNTIENIGMFCNDAENKLRHILDANAPMLSTPTKDYASEPYTAQTVLGMG
NKFLMSSPSGEMNYQSPLSLSKPKEKSVPTPGSAQMTSKSYHKGEKEMDDPKNCKKRKAL
DFLSRVPLPPPVSPICTFVSPAAQKAFQPPRACDTKYETPIRKKELNSPQMTPLKFNDLS
LLESDSIADEELALINTQALLSGLAGENQLMSLSDSTRTAPENLKDYVRPKRHSLASGAK
GCWSPQAHTEERETSVQNLASPVKRASVRLQRRQRQK
NT seq 10374 nt   +upstreamnt  +downstreamnt
atgcctattggatgcaaagagaggccgactttttttgaaatctttaagacgcggtgcaat
gaagcagatttaggacctataagtcttaattggtttgaagaactttctttagaagctcca
tcctataattctgaacccacagaagaatctggatataaaatcagttatgaaccaaaccta
tttaaaacaccacaaaggaaaccttatcatcagttggcttcaactccaataatattccaa
gagcaaggtctaattgtgccaatgtaccaacaatctcctttaaaagaattaggtagatac
agattagactcaggaaaggatattaccaatagtaaacataaaagttgttgcacaatgaag
tctaaaatggatcaaacaaatgatgttaccagcccacccctaaattcttgtcttagtgaa
agtcctttcctacgatgtacacatgtaacaccacaaagagagaagtcagtggtatgtgga
agcttatttcatacaccgaagcttatgaagggtcagacaccaaaacgtatttctgaaagt
ctaggagctgaggtagatcctgatatgtcttggtcaagttctttagccacaccaccaacc
cttagttctactgtgctaatagtcagggatgaggaagcatctgcagctgtatttcctaat
gacactactgctatttttaaaagctgttttcctaaacatgatgaaagtctgaagaaaaac
gataggtgtatcccttctgggccagacaaagaaaacaaaaatcaaagagaagctaaaagt
caaggtttggggaaaatgttagggaattcatttggtaaagtaaatagctgcaaagaccat
tttggaaagtcaacaccaaatgtcctagaagatgaagtacgtgaaatagttgcagatgtt
tctgaagaagatagtttttcattatgtgttcctaaatataaaatgagaaatctaccaaaa
ataaaaactagcaagactaggaaaaatattttcaatgagacaaagaccaatgaatgtgaa
gaaactaaaaagcaaatgaaagaaaataaacattcatttttatctgaaatggaaccaaat
gacagtgatccattagattggagcgtaacaaatccgaagccctttgggaatggaaatgag
aaaatctccaaggaatttgtaccatcttcagcttctgaatggtcccacctaactctctca
ggtctgagtggaacccagatggagaaaacacctctactgcatagttcttcttgtgaccaa
aataattcagaaagagacttcacaattacagagaaagaaagcaccaactttataactttg
ggaaattctttgccacagatttcaagtgtaccaaagtattcagagacgacattaaataag
gaaacagtggtaaataagatagatgaagagcagtgtcttggatctcatgaagattctatt
ctttcaggaaagcaaacaatatctgaaactactgtaatacattctccacttcatggtatc
agaaagtctatattcagaataagagaatcatctgaagagatgtccagtgcagtgttctca
aatcatatgactgatctaaactctaaagaagaaattgacacccctgaaagtgccctggaa
aaatatactatttgctcacagaaagaggattctttaggttcaattgataatggaagctgg
ccagccactatcagacatacttctggagctttgaagacttcaggtttaatatccactttg
aaaaagaaaacaaagaagtttatttatgttataaatgatgaagcatcttatcaaggactg
aaaacacagaaagaccaggaattgggactaactaaccattcagaccaatctgaagcaaat
gcttttgaaggaccactgacatttacaaatgctgattcaggtttattacattcttcttct
gtcaaaaaaaactgtccacagaatgattctgaagaaccagccttgtctttaaccagctct
tttgggacaattctgagaaaagtttccaataatggaaccagttctgttaataataaaaca
gtacctcgggatcttgattataaagaagcaaaaattaataaggaaaagctgcagtcattt
ataaccacagaaactgattgtctatcatccttgccggaaaaacattgtgaagatgatgca
aaaagtcagagagtttcagatataaaagaaaaggtcttgcctgccgtaagttaccctcct
gtgccacattcagaagtagaaggttgtggtattcactttcaatctccagaaagcttttca
tctgaccatgataatactagtctaactcctagctccagagatcctccatcaaacccagtc
atgacttgtagaggaaaagaatcctataaaatgtcagagaaactaaaatgtaagaatcat
aaaggtggttttgaattaatcaaaaatattcccatggaaaagaatcaagaaatgcatgtt
ttaaatgcaaattctaaaaatactgaggtgttgtcaactgaaaaatatgtaatagtagca
tcaccttctatgaaggtacaattcaaccaaaatgcaaatctcaccacaatccaaaaagac
caaaaagaaactactttaatttcaaaaatagctgtcaatccaaactctgaagaacttttc
ccagatgatgagaataatttcgtcttagagataactaatgaaagtaatattcctgtttta
gaaaatattaaggaacttcatgatgcagacctctattgtgtaagagaacctgttctcaag
aactctaccatgatggtatatacagacatggatgacaaacaagcagccaaagtgtcgatt
atgaaggattttgattcatcaaacatagatgatcttacagaaaagaacggaaatagcata
aagcagcaactaaaaatgactctagatcaagattcaaaatcagacatcaccttggaggta
gttaggaaatcaaatggaaataatgactacatgaataattggacaagacaatcagatcca
gtttcaaatcacagttttggaaatggcttcagaacagcttctaataaagagataaaactc
tctgaacacaacattaagaaaagtaaaatgctcttcaaagatattgaagaacattatcct
actaacttagcatgtattgaaattgttaatacctcatcattagaaagtcaaaagaaacta
agcaaacctctcgcacttgatccacagtcaattaatagtatgtcggtctttgtgcagagt
agcgcttatgtttctgatagtgaaagtggtcacatagcccctctaacttcatctttaaag
caagattttaattcaaatcataacttaacacctagccaaaaggcagaaattacagaactt
tctactattttggaagaatcgggaagtcagtttgaatttacacagtttagaaaaccaagc
cacataatagagaaaaatccatttgaaatgcctgaaaaccagctgactatcttgaataga
acttctgaagaatgcagaaatactgatcttcatctcacagttaatgccccatctatcatt
caggtagacagcagtaagaaatttgaaggtgtacttggaggtaaccagaggtttgcttgc
ttgtcgagaaccaactgtaacagaagtgcttgtggctgtttagcagataaaaatgaagtg
aagtttagaggcttttattctgctcgtggcacaaaactgaatgttggtagtgaagcactg
caaaaagctaagcagctgtttagggaccttgagaatatcattgaggaaccttctgtagaa
gtagatacaagaagtttctcctcaggtaaatgtaatgattctgctgtttcaatgattcag
atagaagattgtaacaatgataaaaattttaatgagaaaaataataaaagccaactaata
ctacaaaataatattgaaatgactgctggcatttttgttgaagaaaatagtgaaggttac
aagggaaatacagaaaatgaagataaccagcgtactgatgccagtggaaatactcataac
ttagaatctgttggcaatgattcaaataaaaatgatacagtttatattcatgaagaagaa
aacagcttgctatgtattcatcagcacaacatcgatcaaaaattatctagccagcttatg
aaggagggaaacactcaaattaaagaaggtttgtcagatttaacctgtttggaagttgca
aaagctgaagaaacatttcgtgttaatacgtcaaataagcaacagttaacagctaataca
aagggacaaaacataaaagattttgacatttttgatttatcctttcagacagcaagcagg
aaaaatataagggtctctaaagagtcattaaataaagttataaatctctttgatcaaaaa
tggacagaagaagaattgaataacttttcagattccttgaattctgaattactttctggc
gtagatatcaacaaaatagacatctcaagttatgagaaaacagaaaacagtgaaagaaaa
aacaaaataatgaaagaaagtgacctaattggtactgaaaataaattactgaccctccaa
caaagaccagaaagtgaaatcaaaaagatcaaagaacctactatgttgggttttcataca
gctagtgggaaaaaaatagaaattgcaaaggaatctttggacaaagtgaaaaatcttttt
gatgaaaaagagcaaggtgatagtggaatcactaattttagccatcaaggggcaaagatg
tccaaagacagagagaaatgtgaagatgggcttgaattagcatgtgagaccattgaatta
actgcaccaaagtatgaagaaatgcagaattctctaaaggaaaaaaaacttgtttctagt
gagattgtggtggcacccaggctcttaagtggtaatttaaacaaacaaactgaaaatctt
aaaatatcagatcaagcctctctgaaagttaaagtacatgaaaatacagaaaaagaaaca
gcaaaaaagcatacaatttatacaaatcaattcacttattcagctactgaaaattcacct
ttagcattttacacgggacatggtagaaaaatttctgtgagtgagacttcactatttgaa
gcaaaaaaacggcttagagaaggagaattggatgataaaccagaaaaaataaatactgcc
acggttatctgtttaaaagaatatcttgatgattatgtagaaaatccttcatgtggaaat
agttcaagtagtaccatatctgaaaatgacaaaaatcctccctctgaaaaacaaggcttg
acctatttaagtaatagtaccgtgtctaacaggtattcataccacttggatttttgtcat
cccagtgaggtatataaaaaatcagaatatcttttaaaaaataaagttgataattccggt
actgaaccagtagtgaagaatgttagagaaaacactattttttctgaaataacatccact
gtaagagaagcagacacagacccacaaattataaataaagatatttgtgttcagaaactt
gtgactaactccttgtgcaaaaatgaaaatacagccattaaagtggccatatctgactca
aataattttaattcaattcagaaattgaattcagattcaaatactgctgtacctgcatac
agtacagcaagtagtaaaagagtctttgttgcacaccagacaaaaacgacagagggattt
acagacaactgcagtatgataattaagcaaaaccccaagagtaaatcagacacttgccac
atgagaattgtggcaggttatcctaacacactggacaattcggaggatattatttttcct
gactctctggatgatgcagaacatagttcgtcttcacgtaaggtttttgctggcattcaa
agtgaacacactttacaacttaaccaaagtatatctggattggagaaagtttctgaaata
ccaacttgtcagaataattcaaagacttctgatacatgtaaacttaatacaggaaagctt
ccaaagtcagtctcttgtactaatgcttgcgggatttttagtacagcaagtggaaaatct
gtacaagtatcagatgctgcattacaaaaggcaaggcaggtgttttctaagatagaagat
agtgccaagcaactctttcccaaagtatcatttaaaaatagtgaacattcagacaagttc
acaaatgaagaaaatgctatgctacaaacctcccaaaatttactgttatctactttctct
ggatttagcacagcaagtgggaaacaagttccagtttctgaaagtgctttatgcaaagtt
aagggaatgttagaagaattcgatctgatcagaactgaatgtggtcttcagcattcatct
acatctagacaagatgcgtcaaaaatacctcctccctcttgtattgataagagaacccca
gaacaatgtggcaactccaaattggaaatggcctacaataaagaatttaaattatcaagt
cactgtaacattgagaggggttcttcagaaaatcatcgctccattcaagtctctccatgt
cagtctcagttgaagcaagacaaacagcagttgctattgggaagcaaagtatctcttgtt
gagaacattcatcttttgggaaaagaacaagctttacctaaaaatacaaagacagaaatt
gggaaaactgaaactttccctaatcttccagtgaaaacaaatatagaaatttgttctact
tactccagagatccagaaaactatttggaaacagaaacagtagagattgccagagctttt
atggaagatggtgagctgacagattctgaactgctaagtcatgccaaacactctcttttt
acatgccaaagcactgaggaaatggttttgttaaattcaagaattggaaaaagaagagga
gatgcacttgtctcagttggagaacccccaattaaaagaaacctgttaaatgaattcgac
aggataataaaaaatcaagaaaaatccttaaaagcttcgaaaagcactccagatggcatc
ctaaaagacagaagcttgtttatgcatcatatttctttagagccaattaccagtggaccc
tttagcacaactaaggaacggcaagaaatgcagaatccaaatttcaccgtacctcatcaa
gaatttttgtctaaatctcgtttttatgaacacccggctttggaaaaatcttcaagcaat
ttatcagtttcagggccgccattttgtacagttcctgccacaagaaatgaaaaaaggaga
cacttgaacactccgggcaaaccagtgaaagtctttgtcccaccttttaaaactaaatca
cgttttcacagagatgaacagtgtattagcaagaatactaatttggaagaaaacaaacaa
aacccagaaaacatcgatgaacatggccctggtgagagtgaaacaaatattaatgatggt
ggaattcatcagcttaagaaaaataaccccagtcaagcagcaactataatattcacaaag
tgtgaaaaagaacctttagatttaattacaaatcttcagaatgccagagatatacaggat
atgcggattaagaagaaacaaaggcagcacatttttccacagccaggtagtctgtacctt
gcaaaaacctccactgtgcctagcatctctctgagaggagcagtggaaggccgagtcccc
tctccgtgttctcataaacagctctacatgtatggcgtttccaaacattgtgtaaaaatt
aacagcaaaaatgcagagtcttttcagtttcacactgaggattattttggtaaggaagga
ctatggtctggagagggaatacagttggctgacggtggatggctcataccctccaatgat
ggaaaggctggaaaagaagaattttatagggctctgtgtgacaccccaggtgtggatcca
aatcttatttctagagtttgggtgtataatcactacagatggattatatggaaactggca
gctttggaatttgcctttcctaaggaatttgctaataggtgcctaagcccagaaagagtg
cttcttcaactaaaatacagatatgatgtggaaattgatagaagcagaagatcagcctta
aagaagatcatggaaagggatgacacagctgcaaaaactcttgttctctgtatttctgaa
ataatttcatcaagcgtagatatatctgaaacttccagcagtaaaactaatagtgtgggt
accaaaaaagtgggcattgttgagctcacagatggatggtatgctgttaaggcccagtta
gatcctcccctctcagctcttgtaaagaatggtaaattgactgtgggtcagaagatcatt
actcatggagcagaactggttggctctcctgatgcctgcacaccactcgaagccccagaa
tctcttatgttaaagattgctgctaacagtactcgtcgtgctcgctggtatgccaaactt
ggattctctcctgatcctagaccttttcctctctccttgtcatcacttttcagtgatgga
ggaaatgttggttgtgttgatgtagttgttcaaagagcatatccaatacagtggatggag
aggaccccttctggattatgcatatttcggaatgaacgagaggaagaaaaggaggcaacg
aaatatgcagaagcccaacaaaagaaactagaagtcttattcaataaaattcaaggggaa
tttgaaaagcatgacgagaatatatcgaaacaatgtagaccatcatgcgcattaacaaga
cagcaagtctgtgctctgcaagatggtgcagagctttatgaagcagtgacgaatgcacca
gacccggcttatctggagggttactttagtgaagagcagttaagagccttgaataatcac
agacagatgttgaatgataagaagcaagcacagatccagttggaattcaggaaggctatg
gaatctgctgagcaaggagagcaaattttatcaaggaatgttacaactgtgtggaagttg
cgtatcataagctatgggaagaaagaaaaagattcagttacattgagtatctggcgtccg
tcatcagatttatattccctgttaacagaaggaaagagatacagaatctatcatcttgca
acatcacaatctaaaagtaaatctgaaaaagttaacatacaactaacagcaacaaagaaa
acccagtatcaacagctacaggcttcagatgaaatcctatgccaaatttatcagccaagg
gagcccctttacttcaacaaactattgagtccagacttccaaccaccttgttctgaggtg
gacctagtaggatttgtaatttctgttgtgaaaaaaataggtcttgctcctttggtctat
ttgtcagatgaatgccataatttattggcaataaagttttggatcgatcttaatgaggac
attattaaacctcacaccttaattgctgcaagcaacctccagtggcgaccagaagccaaa
tcaggaattcctactttatttgctggagatttttccaggttttctgccagtccaaaggag
ggccattttcaagagatattccacaaaatgaaaaataccattgagaatattggtatgttt
tgcaatgatgcagaaaacaaacttaggcatatacttgatgcaaacgctcctatgttgtcc
accccgactaaagactatgcttcagagccatacactgctcaaacagtccttggcatggga
aataaatttctgatgtcttctcccagtggtgagatgaattaccagagtcctttatcactt
tctaagccgaaagagaagtctgttcccacacctggatcagcccagatgacttcaaagtct
tatcataaaggggagaaagagatggatgacccaaaaaattgcaagaagagaaaagcctta
gattttttgagtagagtgcctttacctccacctgtcagtcccatctgtacatttgtttct
ccagctgcacagaaggcatttcagccaccacgggcttgtgacaccaaatatgaaacacct
ataaggaagaaagagttgaattctcctcagatgactccactcaaatttaatgacctttcc
cttttggaaagtgattcaatagcagatgaagaactcgcactgatcaacactcaagccctt
ttgtcgggtttggcaggagaaaatcaacttatgtctctcagtgactccacgaggactgct
cctgagaacttaaaagattatgtcaggccaaaaaggcattctctggcatctggggcaaaa
ggatgctggagcccccaagcccacaccgaagagcgggagaccagtgtgcaaaaccttgca
agtcctgtgaaaagggcatctgtgagactgcaaaggcgacaaagacaaaaatga

DBGET integrated database retrieval system