KEGG   Enhydra lutris kenyoni (northern sea otter): 111159001
Entry
111159001         CDS       T05871                                 

Definition
(RefSeq) catenin beta-1
  KO
K02105  catenin beta 1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04015  Rap1 signaling pathway
elk04310  Wnt signaling pathway
elk04390  Hippo signaling pathway
elk04510  Focal adhesion
elk04520  Adherens junction
elk04550  Signaling pathways regulating pluripotency of stem cells
elk04670  Leukocyte transendothelial migration
elk04916  Melanogenesis
elk04919  Thyroid hormone signaling pathway
elk04934  Cushing syndrome
elk05010  Alzheimer disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05100  Bacterial invasion of epithelial cells
elk05132  Salmonella infection
elk05160  Hepatitis C
elk05163  Human cytomegalovirus infection
elk05165  Human papillomavirus infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05200  Pathways in cancer
elk05205  Proteoglycans in cancer
elk05210  Colorectal cancer
elk05213  Endometrial cancer
elk05215  Prostate cancer
elk05216  Thyroid cancer
elk05217  Basal cell carcinoma
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
elk05412  Arrhythmogenic right ventricular cardiomyopathy
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    111159001
   04310 Wnt signaling pathway
    111159001
   04390 Hippo signaling pathway
    111159001
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111159001
   04520 Adherens junction
    111159001
   04550 Signaling pathways regulating pluripotency of stem cells
    111159001
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    111159001
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    111159001
   04916 Melanogenesis
    111159001
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111159001
   05205 Proteoglycans in cancer
    111159001
  09162 Cancer: specific types
   05210 Colorectal cancer
    111159001
   05225 Hepatocellular carcinoma
    111159001
   05226 Gastric cancer
    111159001
   05216 Thyroid cancer
    111159001
   05217 Basal cell carcinoma
    111159001
   05215 Prostate cancer
    111159001
   05213 Endometrial cancer
    111159001
   05224 Breast cancer
    111159001
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111159001
   05022 Pathways of neurodegeneration - multiple diseases
    111159001
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111159001
   05412 Arrhythmogenic right ventricular cardiomyopathy
    111159001
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111159001
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111159001
   05100 Bacterial invasion of epithelial cells
    111159001
  09172 Infectious disease: viral
   05160 Hepatitis C
    111159001
   05163 Human cytomegalovirus infection
    111159001
   05167 Kaposi sarcoma-associated herpesvirus infection
    111159001
   05165 Human papillomavirus infection
    111159001
SSDB
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 111159001
NCBI-ProteinID: XP_022377068
UniProt: A0A2Y9L6J3
LinkDB
Position
Unknown
AA seq 781 aa
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTT
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggctacccaagctgatttgatggagctggacatggccatggagccagacagaaaagca
gctgttagtcactggcagcaacaatcttacctggactctggaatccattctggtgccact
accacagctccttctctgagtggtaaaggcaatcctgaggaagaggatgtggataccacc
caagtcctgtacgagtgggagcagggcttttctcagtccttcactcaagaacaagtagct
gatatcgatggtcagtatgcgatgactcgagctcagagggtgcgagccgcaatgttccct
gagacgttagatgagggcatgcagatcccatctacacagttcgatgctgctcatcctact
aatgtccagcgtttggccgaaccatcacagatgctgaaacacgcagttgtaaatttgatt
aactatcaagatgatgcagaacttgccacacgtgcaatccctgaactgacaaaactgcta
aacgatgaggaccaggtggtggttaataaggctgcagttatggtccatcagctttctaaa
aaggaagcttccagacacgccatcatgcgttctcctcagatggtgtctgctattgtacgc
accatgcagaatacaaatgatgtggaaaccgctcgctgtactgctgggaccttgcacaat
ctttctcatcatcgtgagggattgctggccatctttaagtctgggggcattcctgccctg
gtgaagatgcttggttcaccagtggattctgtattattttatgccattacaactctccac
aaccttttattgcatcaagaaggagctaaaatggcagtgcgtttagctggtgggctgcag
aaaatggttgccttgctcaacaaaacaaatgttaaattcttggctattacaacagactgc
cttcagattttagcttacggcaatcaagaaagcaagctgatcattctggcaagtggtgga
cctcaagctttagtaaatataatgaggacctacacttatgagaaactactatggaccaca
agcagggtactgaaggtgctgtctgtctgctctagtaataaaccagctattgtagaagca
ggtggaatgcaagctttagggcttcacctgacagatccaagtcaacgtcttgttcagaat
tgtctttggactcttaggaatctatcagatgctgcaactaaacaggaagggatggaaggt
cttcttgggacccttgttcagcttctgggctcagatgatataaatgtggtcacctgtgca
gctggaattctttctaatctcacctgcaataattataagaacaagatgatggtctgccaa
gtgggtggtatagaggctcttgtccgtactgtccttcgagctggtgacagggaggatatt
actgagcctgccatctgtgctcttcgtcatctgaccagccgacaccaggaagcagagatg
gctcagaatgctgttcgtcttcactatggactaccagttgtggttaaactcctgcaccct
ccatcccattggcctctgataaaggctactgttggattgattcgaaatcttgccctttgt
ccggcaaatcatgcacctctgcgtgagcagggtgccattccgcgactagttcagttgctg
gttcgtgcccatcaggatacccagcgccgtacatctatgggcggaacacagcagcagttt
gtggagggggtccgtatggaagaaattgttgaaggttgtactggagcccttcatatccta
gctcgggatgttcacaaccgaatcgtaatcagaggactaaataccattccattgtttgtg
cagctgctttattctcccattgaaaatatccaaagagtagctgcaggggtcctctgtgaa
cttgctcaggacaaggaggctgcagaagccatcgaagcggagggagccacggctcctctg
acagagttacttcactctaggaacgaaggtgtagcaacatacgcagctgctgttctgttc
cgtatgtctgaggataagccacaggattataagaaacgactttcggttgagctgaccagt
tctctcttcagaacagagccaatggcttggaatgagactgctgatcttggacttgatatt
ggtgcccagggagaaccccttggatatcgccaggatgatcccagctatcgttcttttcac
tctggtggatatggccaggatgctttggggatggaccccatgatggagcatgagatgggt
ggccaccaccctggtgctgactatccagttgatgggctgccagatctggggcatgcccag
gacctcatggatgggctgcctccaggtgacagcaatcagctggcctggtttgatactgac
ctgtaa

DBGET integrated database retrieval system