KEGG   Enhydra lutris kenyoni (northern sea otter): 111159091
Entry
111159091         CDS       T05871                                 

Definition
(RefSeq) DNA mismatch repair protein Mlh1 isoform X1
  KO
K08734  DNA mismatch repair protein MLH1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01524  Platinum drug resistance
elk03430  Mismatch repair
elk03460  Fanconi anemia pathway
elk05200  Pathways in cancer
elk05210  Colorectal cancer
elk05213  Endometrial cancer
elk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    111159091
   03460 Fanconi anemia pathway
    111159091
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111159091
  09162 Cancer: specific types
   05210 Colorectal cancer
    111159091
   05226 Gastric cancer
    111159091
   05213 Endometrial cancer
    111159091
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111159091
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:elk03400]
    111159091
DNA repair and recombination proteins [BR:elk03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     111159091
SSDB
Motif
Pfam: Mlh1_C DNA_mis_repair HATPase_c_3 HATPase_c
Other DBs
NCBI-GeneID: 111159091
NCBI-ProteinID: XP_022377189
UniProt: A0A2Y9L0V0
LinkDB
Position
Unknown
AA seq 758 aa
MSLVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVVVKEGGLKLIQ
IQDNGTGIRKEDLDIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTA
DAKCAYRANYSDGKLKAPPKPCAGNQGTQITVEDLFYNISTRRKALKNASEEYGKILEVV
GRYSIHNSGISFSVKKQGETVADVRTLPNATTVDNIRSIFGNAVSRELIEVGCEDKTLAF
KMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISP
QNVDVNVHPTKHEVHFLHEDSILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEVV
KSTTGVTPSSASGSGDKVYAHQMVRTDSREQKLDAFLQPMSKALSSQPQAIVPEDRTDAS
SGRPGQQDEEMLELPEPAQASATNQGTEEDATEGTSEISERRGPPSSPGNPRKRPRESSD
VEMAEDDSRKEMTAACTPRRRIINLTSVLSLQEEINARGHETLREMLQNHSFVGCVNPQW
ALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWT
EEDGPKEGLAEYIVEFLKKKAEMLTDYFSLEIDEEGNLTGLPLLIDNYVPPLEGLPIFIL
RLATEVNWDEEKECFESLSKECAMFYSIRKQYVSEESTLSGQEGEVSGSSANPWKRTVEH
VVYKAFRSHLLPPRHFTEDGNILQLANLPDLYKVFERC
NT seq 2277 nt   +upstreamnt  +downstreamnt
atgtcgctcgtagcgggggttattcggcggttggacgagacagtggtgaaccgcatcgcg
gcaggggaagttatccagcggccggctaatgccatcaaggagatgattgagaactgttta
gatgcaaaatccaccagtatccaagtggttgttaaagagggaggcctcaagttaattcag
atccaagacaatggcactgggatcaggaaggaagatctggacattgtgtgtgagaggttc
actacaagtaaactgcagtcctttgaggatttagctagtatttctacctatggctttcgg
ggtgaggctttggccagcatcagccatgtggctcatgttactattacaaccaaaacagct
gatgcaaagtgtgcgtacagagcaaattactcagatggaaagctgaaagctcctcctaaa
ccatgtgcaggcaatcaggggacccagatcacagtggaggaccttttttacaacatatcc
acgaggaggaaagctttaaaaaatgcaagtgaagagtatgggaaaattttggaagttgtt
ggcaggtattcaatacacaattcaggcattagtttctcagttaaaaaacaaggtgagacc
gtggctgacgttaggacactgcccaatgccacaacggtggacaatattcgctccatcttt
ggaaatgctgtcagccgagaactgatagaagttgggtgtgaggataaaaccctggccttc
aaaatgaatggttacatatccaatgcaaattactcagtgaagaagtgcatcttcttactc
ttcatcaaccatcgtctggtagagtcaacttctttaagaaaagccattgaaacagtgtat
gccgcatatttgcccaaaaacacacacccattcctgtacctcagtttagagatcagcccc
cagaacgtggacgtcaacgtgcaccccacaaagcacgaagttcacttcctgcatgaggac
agcatcctggagcgggtgcagcagcacattgagagtaagctcctgggctccaactcctcc
agaatgtacttcacccagactttactaccaggtcttgctggcccctccggggaggtggtt
aaatccacaacaggtgtgaccccctcatctgcttctggaagtggcgacaaggtctatgcc
caccagatggtccgcacagattcacgggaacagaagctcgatgcctttctgcaacccatg
agcaaggcactgtccagtcagcctcaggccattgttccagaagacaggaccgatgcttcc
agtggcaggcctggacagcaagatgaggaaatgcttgaactcccagagcctgctcaagca
tctgccacaaatcagggcacagaggaagatgcaacagaggggacttcagaaatatcagag
aggagagggcccccttccagcccgggcaaccccagaaagaggccccgggaaagctctgat
gtagaaatggcggaagatgattcccgaaaggaaatgacagcagcgtgtacccctcggcgg
aggatcatcaacctcaccagtgtgctgagcctccaggaagaaattaacgcacggggacat
gagacactccgagagatgctgcagaaccactcctttgtgggctgcgtgaatccgcagtgg
gccttggcacagcatcagaccaagttataccttctcaacaccaccaaactgagtgaagaa
ctgttctaccagatactcatttatgattttgccaattttggtgttctcaggctctcggag
ccagcaccgctgtttgacctggccatgctagccttggatagtcctgagagtggctggacg
gaggaagatggtcccaaagaaggacttgccgagtacattgttgagtttctgaagaagaag
gctgagatgctcacagactatttctctttggaaatcgatgaggaagggaacctgactgga
ttgcccctgctgatcgacaactatgtgcctcctttggaaggtctgcctatcttcattctt
cgactagccacggaggtgaactgggatgaagagaaggaatgttttgaaagcctcagtaaa
gaatgtgctatgttttactccattcggaagcagtatgtatctgaggagtcgaccctctca
ggccaggagggggaagtgtccggctcctctgcaaacccctggaagcggactgtggaacac
gttgtctataaagccttccgctcacaccttctgcctcctagacatttcacagaagatgga
aatatcctacagcttgctaacctgcccgatctgtacaaagtcttcgagaggtgctaa

DBGET integrated database retrieval system