KEGG   Enhydra lutris kenyoni (northern sea otter): 111159151
Entry
111159151         CDS       T05871                                 

Definition
(RefSeq) C-C chemokine receptor type 4
  KO
K04179  C-C chemokine receptor type 4
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04060  Cytokine-cytokine receptor interaction
elk04061  Viral protein interaction with cytokine and cytokine receptor
elk04062  Chemokine signaling pathway
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111159151
   04061 Viral protein interaction with cytokine and cytokine receptor
    111159151
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    111159151
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111159151
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    111159151
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:elk04030]
    111159151
   04050 Cytokine receptors [BR:elk04050]
    111159151
   04090 CD molecules [BR:elk04090]
    111159151
G protein-coupled receptors [BR:elk04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    111159151
Cytokine receptors [BR:elk04050]
 Chemokine receptors
  CC Chemokine
   111159151
CD molecules [BR:elk04090]
 Proteins
  111159151
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 111159151
NCBI-ProteinID: XP_022377290
UniProt: A0A2Y9L765
LinkDB
Position
Unknown
AA seq 360 aa
MNPTDIADTTLDESVYSNYYLYENIPKPCTKEGIKAFGELFLPPLYYLVFLFGLLGNSVV
VLVLFKYKRLKSMTDVYLLNLAISDLLFVLSLPFWGYYAADQWVFGLGLCKIISWMYLVG
FYSGIFFIMLMSIDRYLAIVHAVFSLRARTLTYGVITSLATWSVAVLASLPGLLFSTCYT
ERNHTYCKTKYSLNSTRWKVLSSLEINILGLVVPLGTMLFCYSMIIRTLQHCKNEKKSKA
VRMVFAVVALFLGFWAPYNVVLFLETLVELGVLQDCTFERHLDYAIQATETLAFVHCCLN
PVIYFFLGEKFRKYIVQLFKTCRGPFMCCQYCRLLQLYAPDTPSSSYTQSTGDHDLHDAL
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaaccccacggatatagcagacaccaccctggatgaaagtgtctatagcaattactat
ctctacgaaaacatccccaagccttgcaccaaagaaggcatcaaagcgtttggggagctc
ttcctgccccctctctactacttggtctttctgtttggtctccttggaaattctgtggtg
gtgctagtcctgttcaagtacaaaaggcttaagtccatgactgacgtgtacctgctcaac
cttgccatctcggacctgctcttcgtgctctccctccctttctggggctactatgctgca
gaccagtgggtttttggactcggtctctgcaagatcatttcctggatgtacttggtgggt
ttttatagtggcatcttcttcatcatgctcatgagcattgacagatacctggcgattgtg
catgcggtgttctccctgagagcgaggaccttgacttatggggtcatcaccagtttggcc
acatggtctgtggctgtactggcctcccttccaggccttttattcagcacgtgttatacc
gagcgcaaccacacctactgcaaaaccaagtactctctcaactccacaaggtggaaggtg
ctgagctctctggagatcaacattctcggattggtggttcccttgggcaccatgttgttc
tgctactccatgatcatcaggacactgcagcactgcaaaaatgagaagaagagcaaggcg
gtgaggatggtctttgctgtggtggccctcttcctggggttctgggcaccttacaatgtg
gtgcttttcctggagacactggtggagctgggggtccttcaggactgcacctttgaaagg
cacctggactacgccattcaggccacagagaccctggctttcgttcactgctgccttaat
ccagtcatctactttttcctcggggagaaattccgcaagtacatcgtacagctcttcaaa
acctgcaggggaccgttcatgtgctgccaatactgtaggctcctccagctctacgcccct
gacactcccagctcctcctacacgcagtccaccggggatcacgatctccatgatgccctg
tga

DBGET integrated database retrieval system