KEGG   Enhydra lutris kenyoni (northern sea otter): 111159342
Entry
111159342         CDS       T05871                                 

Definition
(RefSeq) integrin-linked protein kinase isoform X1
  KO
K06272  integrin-linked kinase [EC:2.7.11.1]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk03320  PPAR signaling pathway
elk04360  Axon guidance
elk04510  Focal adhesion
elk05100  Bacterial invasion of epithelial cells
elk05213  Endometrial cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111159342
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    111159342
  09158 Development and regeneration
   04360 Axon guidance
    111159342
 09160 Human Diseases
  09162 Cancer: specific types
   05213 Endometrial cancer
    111159342
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    111159342
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111159342
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:elk03036]
    111159342
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111159342
Protein kinases [BR:elk01001]
 Serine/threonine kinases: TKL group
  MLK family
   111159342
Chromosome and associated proteins [BR:elk03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    111159342
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ank_4 Ank_5 Pkinase Ank_2 Ank Ank_3
Other DBs
NCBI-GeneID: 111159342
NCBI-ProteinID: XP_022377446
UniProt: A0A2Y9L7T2
LinkDB
Position
Unknown
AA seq 452 aa
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARI
NVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLV
ANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNG
TLNKHSGIDYKQLNFLAKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECP
RLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALD
MARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEA
LQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPH
VCKLMKICMNEDPAKRPKFDMIVPILEKMQDK
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggacgacattttcactcagtgccgggagggcaacgcggtggccgttcgcctgtggctg
gacaacacggagaacgacctcaaccagggggatgatcatggcttctcccccttgcactgg
gcctgccgagagggccgttctgctgtggttgagatgctgatcatgcggggggcacgaatc
aatgtgatgaaccgtggggatgacacccccctgcacctggcagccagtcatggacaccgt
gatattgtgcagaagctcttgcagtataaagctgacattaatgcagtgaatgagcatgga
aacgtgcccctgcactatgcctgtttttggggccaagatcaggttgcagaggacctggta
gctaatggggctcttgtcagcatttgtaacaagtatggagagatgcctgtggacaaagcc
aaggcacccctgagagagctcctccgagagcgggcagagaagatgggccagaaccttaac
cgtattccatacaaggacactttctggaagggaaccacccgcactcggccccgaaatggg
actctgaacaaacactccggcattgactacaaacagctcaactttttggcaaagctcaac
gagaatcactctggagagctatggaagggccgttggcagggcaatgacatcgttgtgaag
gtgctaaaggttcgagactggagtacaaggaagagcagggacttcaacgaggagtgtccc
cgtctcaggattttctcgcatccaaatgtgctcccagtgctaggtgcctgtcagtctccg
cctgctcctcaccccaccctcatcacacactggatgccatatggatccctgtacaatgta
ttacatgaaggcaccaattttgttgtggaccagagccaggctgtgaagtttgcgttggac
atggcaaggggcatggccttcctacacacattagagcccctcatcccacgacatgcactc
aatagccgtagtgtaatgattgatgaggatatgactgcccgaatcagcatggccgacgtc
aagttctccttccaatgccctgggcgcatgtatgcacctgcctgggtggcccctgaagca
ctgcagaagaagcctgaagatacaaacagacgctcagcagacatgtggagttttgcagtg
cttctgtgggaactggtgacacgggaggtaccctttgctgacctctccaacatggagatt
ggaatgaaggtggcactggaaggccttcggcctactatcccaccaggcatttccccccat
gtgtgtaagctcatgaagatctgcatgaatgaagaccctgctaagcggcctaaatttgac
atgattgtgcctatcctggagaagatgcaggacaagtag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111159383
Entry
111159383         CDS       T05871                                 

Definition
(RefSeq) integrin-linked protein kinase isoform X1
  KO
K06272  integrin-linked kinase [EC:2.7.11.1]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk03320  PPAR signaling pathway
elk04360  Axon guidance
elk04510  Focal adhesion
elk05100  Bacterial invasion of epithelial cells
elk05213  Endometrial cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111159383
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    111159383
  09158 Development and regeneration
   04360 Axon guidance
    111159383
 09160 Human Diseases
  09162 Cancer: specific types
   05213 Endometrial cancer
    111159383
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    111159383
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111159383
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:elk03036]
    111159383
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111159383
Protein kinases [BR:elk01001]
 Serine/threonine kinases: TKL group
  MLK family
   111159383
Chromosome and associated proteins [BR:elk03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    111159383
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ank_4 Ank_5 Pkinase Ank_2 Ank Ank_3
Other DBs
NCBI-GeneID: 111159383
NCBI-ProteinID: XP_022377505
UniProt: A0A2Y9L7T2
LinkDB
Position
Unknown
AA seq 452 aa
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARI
NVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLV
ANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNG
TLNKHSGIDYKQLNFLAKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECP
RLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALD
MARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEA
LQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPH
VCKLMKICMNEDPAKRPKFDMIVPILEKMQDK
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggacgacattttcactcagtgccgggagggcaacgcggtggccgttcgcctgtggctg
gacaacacggagaacgacctcaaccagggggatgatcatggcttctcccccttgcactgg
gcctgccgagagggccgttctgctgtggttgagatgctgatcatgcggggggcacgaatc
aatgtgatgaaccgtggggatgacacccccctgcacctggcagccagtcatggacaccgt
gatattgtgcagaagctcttgcagtataaagctgacattaatgcagtgaatgagcatgga
aacgtgcccctgcactatgcctgtttttggggccaagatcaggttgcagaggacctggta
gctaatggggctcttgtcagcatttgtaacaagtatggagagatgcctgtggacaaagcc
aaggcacccctgagagagctcctccgagagcgggcagagaagatgggccagaaccttaac
cgtattccatacaaggacactttctggaagggaaccacccgcactcggccccgaaatggg
actctgaacaaacactccggcattgactacaaacagctcaactttttggcaaagctcaac
gagaatcactctggagagctatggaagggccgttggcagggcaatgacatcgttgtgaag
gtgctaaaggttcgagactggagtacaaggaagagcagggacttcaacgaggagtgtccc
cgtctcaggattttctcgcatccaaatgtgctcccagtgctaggtgcctgtcagtctccg
cctgctcctcaccccaccctcatcacacactggatgccatatggatccctgtacaatgta
ttacatgaaggcaccaattttgttgtggaccagagccaggctgtgaagtttgcgttggac
atggcaaggggcatggccttcctacacacattagagcccctcatcccacgacatgcactc
aatagccgtagtgtaatgattgatgaggatatgactgcccgaatcagcatggccgacgtc
aagttctccttccaatgccctgggcgcatgtatgcacctgcctgggtggcccctgaagca
ctgcagaagaagcctgaagatacaaacagacgctcagcagacatgtggagttttgcagtg
cttctgtgggaactggtgacacgggaggtaccctttgctgacctctccaacatggagatt
ggaatgaaggtggcactggaaggccttcggcctactatcccaccaggcatttccccccat
gtgtgtaagctcatgaagatctgcatgaatgaagaccctgctaagcggcctaaatttgac
atgattgtgcctatcctggagaagatgcaggacaagtag

DBGET integrated database retrieval system