KEGG   Enhydra lutris kenyoni (northern sea otter): 111159674
Entry
111159674         CDS       T05871                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04010  MAPK signaling pathway
elk04020  Calcium signaling pathway
elk04022  cGMP-PKG signaling pathway
elk04024  cAMP signaling pathway
elk04260  Cardiac muscle contraction
elk04261  Adrenergic signaling in cardiomyocytes
elk04270  Vascular smooth muscle contraction
elk04713  Circadian entrainment
elk04720  Long-term potentiation
elk04723  Retrograde endocannabinoid signaling
elk04724  Glutamatergic synapse
elk04725  Cholinergic synapse
elk04726  Serotonergic synapse
elk04727  GABAergic synapse
elk04728  Dopaminergic synapse
elk04742  Taste transduction
elk04911  Insulin secretion
elk04912  GnRH signaling pathway
elk04921  Oxytocin signaling pathway
elk04924  Renin secretion
elk04925  Aldosterone synthesis and secretion
elk04927  Cortisol synthesis and secretion
elk04929  GnRH secretion
elk04930  Type II diabetes mellitus
elk04934  Cushing syndrome
elk04935  Growth hormone synthesis, secretion and action
elk05010  Alzheimer disease
elk05020  Prion disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05031  Amphetamine addiction
elk05410  Hypertrophic cardiomyopathy
elk05412  Arrhythmogenic right ventricular cardiomyopathy
elk05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111159674
   04020 Calcium signaling pathway
    111159674
   04024 cAMP signaling pathway
    111159674
   04022 cGMP-PKG signaling pathway
    111159674
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    111159674
   04929 GnRH secretion
    111159674
   04912 GnRH signaling pathway
    111159674
   04921 Oxytocin signaling pathway
    111159674
   04935 Growth hormone synthesis, secretion and action
    111159674
   04924 Renin secretion
    111159674
   04925 Aldosterone synthesis and secretion
    111159674
   04927 Cortisol synthesis and secretion
    111159674
  09153 Circulatory system
   04260 Cardiac muscle contraction
    111159674
   04261 Adrenergic signaling in cardiomyocytes
    111159674
   04270 Vascular smooth muscle contraction
    111159674
  09156 Nervous system
   04724 Glutamatergic synapse
    111159674
   04727 GABAergic synapse
    111159674
   04725 Cholinergic synapse
    111159674
   04728 Dopaminergic synapse
    111159674
   04726 Serotonergic synapse
    111159674
   04720 Long-term potentiation
    111159674
   04723 Retrograde endocannabinoid signaling
    111159674
  09157 Sensory system
   04742 Taste transduction
    111159674
  09159 Environmental adaptation
   04713 Circadian entrainment
    111159674
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111159674
   05020 Prion disease
    111159674
   05022 Pathways of neurodegeneration - multiple diseases
    111159674
  09165 Substance dependence
   05031 Amphetamine addiction
    111159674
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    111159674
   05412 Arrhythmogenic right ventricular cardiomyopathy
    111159674
   05414 Dilated cardiomyopathy
    111159674
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111159674
   04934 Cushing syndrome
    111159674
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:elk04040]
    111159674
Ion channels [BR:elk04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   111159674
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel Etmic-2 DUF4834
Other DBs
NCBI-GeneID: 111159674
NCBI-ProteinID: XP_022377939
UniProt: A0A2Y9L2V7
LinkDB
Position
Unknown
AA seq 2176 aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAAR
QAKLMGSAGNATISTVSSTQRKRQQYGKPKKQGSTTATRPPRALLCLTLKNPIRRACISI
VEWKYPLPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLK
VIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALR
AFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKT
CYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVF
QCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKA
RGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPRNMSMPTSETESVNTE
NVAGGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLN
TLTIASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVC
GGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLL
LFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIM
AYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKK
LARTASPEKKQEVVEKPAVEETKEEKIELKSITADGESPPTTKINMDDLQPNENEDKSPY
PNPENTGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSPNNRFRLQCHRIV
NDTIFTNLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKMTAYGA
FLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKH
VVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYK
DGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYN
YRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKAR
PLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNML
FTGLFTVEMILKLIAFKPKHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSPFMNA
EENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVI
GMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEP
SNSTEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF
KRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVM
FNATLFALVRTALRIKTEASHSEQGSHPMGPSGVDPQGADDHFQPHISLPSGNLEQANEE
LRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPS
QRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFG
NHVSYYQSDSRNAFPQTFTTQRPLHINKAANSQGDTESPSHEKLVDSTFTPSSYSSTGSN
ANINNANNTALGRFPRPAGYPSAVSTVEGHGPPLSPAVRVQEAAWKLSSKRCHSRESQIA
MVCQEEVSQDETYEVKLSEDTEYCSEPSLISTELISYQDDENRQLTPPEEDRRDIRQSPK
RGFLRSASLGRRASFHLECLKRQKNQGGDISQKTVLPLHLVHHQALAVAGLSPLLQRSHS
PSTFPRPCATPPATPGSQGWPPQPIPTLRLEGAESSEKLNSSFPSIHCSSWSGEPAPCGG
GSSALRRARPVSLTVPSQAGARGRPFYGSASSLVGAVLISEGLGQFAQDPKFIEVTTQEL
ADACDMTIEEMENAADNILSGGTQQSPNGTLLPFVNCRDPGQDRAGGQEGESCAGARACR
KSEEERQDSRAHTGSL
NT seq 6531 nt   +upstreamnt  +downstreamnt
atggtcaatgagaacacgaggatgtacattccagaggaaaaccatcaaggttccaactat
gggagcccgcgcccagctcatgccaacatgaacgccaatgctgctgcagggctcgcccct
gagcacatccctacgccgggggctgccttgtcctggcaggcggccattgatgcggcccgg
caggccaagctgatgggcagcgccggcaacgcgaccatctccacggtcagctccacgcag
cggaagcggcagcagtatggaaagcccaagaagcagggcagcacgacggccacgcgcccg
ccccgcgccctgctctgcctgactctgaagaaccccatcaggagggcgtgcatcagcatc
gtcgaatggaaatatcctttaccatttgaaataattattttactgactatttttgccaat
tgtgtggccttagcgatctatattccctttccagaagacgactccaacgccaccaattcc
aacctggaacgagtggaatatctctttctcataatttttactgtggaagcatttttaaaa
gtaatagcctatggacttctctttcaccccaacgcttacctccgcaatggttggaattta
ctagattttataattgtggttgtagggctttttagtgcaattttagaacaagcaaccaaa
gccgacggggcaaatgctctgggagggaaaggagctggatttgacgtgaaggcactgagg
gcattccgtgtgctgcgcccgttgcgcctggtgtctggagtcccaagcctccaggtggtt
ctgaattccattatcaaggctatggtgcccctgctgcatattgccctgttagtgctgttt
gttatcatcatctatgccatcattggcctggagcttttcatggggaagatgcataagacc
tgctacaaccaggagggcatagcagatgttccagcagaagatgatccttccccttgtgct
ctggagacaggccatgggcggcagtgtcagaacggcactgtgtgcaagcccgggtgggac
gggcccaagcacggcatcaccaacttcgacaattttgccttcgccatgttgacggtgttc
cagtgcatcacaatggagggctggacagatgtgctgtactgggtcaatgatgccgtagga
agggactggccctggatctattttgttacactaatcatcatagggtcattttttgtactt
aacttggttctcggtgttcttagcggagagttttccaaagagagggagaaggccaaggct
cggggagatttccagaagcttcgagagaagcagcagctagaagaggacctgaagggctac
ctggactggatcacccaggcagaggacattgaccccgagaatgaggatgaaggcatggat
gaggaaaagccccgaaacatgagcatgcccacaagtgagaccgagtctgtcaacaccgaa
aacgtggctggaggtgacatcgagggagagaactgcggggccaggctggcccaccggatt
tccaaatcaaagttcagccgctattggcgccggtggaatcggttctgtagaagaaagtgt
cgtgctgcagtcaagtctaatgtcttctactggcttgtgatcttccttgtgttcctcaac
acactcaccatcgcctcagaacactacaaccagccccactggctcacggaggtccaagac
acggccaacaaggcactgctggcccttttcactgcagagatgctgctgaagatgtacagc
ctgggcctgcaggcctactttgtctccctgttcaaccgcttcgactgcttcattgtgtgt
gggggcatcctggagaccatcctggtagagaccaagatcatgtctcccttgggcatctct
gtgctgagatgtgtccggctactgcggatatttaaaatcacaaggtactggaactcctta
agcaacctggtggcatccttgctgaattctgtgcgctccattgcctccctgctgctgctc
ctcttcctcttcatcatcatcttctccctcctggggatgcagctctttggaggaaagttc
aactttgatgaaatgcagacccggaggagcacatttgataactttccccagtcccttctc
accgtgtttcagatcctgaccggggaggactggaattcggtgatgtatgatgggatcatg
gcttatggcggcccctcttttccagggatgttagtctgtatttacttcatcatcctcttc
atctgtggaaactatatcctactgaatgtgttcttggccattgctgtggacaacctggcg
gatgctgagagcctcacgtctgcccaaaaggaggaggaagaagagaaggagagaaagaag
ctggccaggactgccagcccagagaagaaacaagaggtggtggagaagccagcagtggag
gagaccaaggaggagaaaattgaactgaaatctattactgctgatggagagtccccaccc
accaccaagatcaacatggatgacctccagcccaatgaaaatgaggataagagtccctac
cccaacccagaaaatacaggagaagaggatgaggaggagcctgagatgcctgtgggcccc
cgcccccgcccgctctcggagctgcacctgaaggaaaaggcagtgcccatgccagaagcc
agtgcgtttttcatcttcagccccaacaacagatttcgcctccagtgtcaccgcattgtc
aatgacacgatcttcaccaacctgatcctcttcttcattctgctcagcagcatttccctg
gcggctgaggaccccgtccagcacacctccttcaggaaccatattctgttttattttgac
attgttttcactaccattttcaccattgaaattgctctgaagatgactgcttatggggct
ttcctacacaagggctctttttgccgaaactacttcaacatcttggacctgctggtggtc
agcgtgtccctcatttcctttggcatccagtccagtgcaatcaacgtggtgaagatcttg
cgagtcctgagagtcctcaggcccctgagggccatcaacagggccaaggggctaaagcac
gtggttcagtgcgtgttcgtcgccatccggaccatcgggaacatcgtgattgtaaccacg
ctgcttcagttcatgttcgcctgcatcggtgtgcagcttttcaagggaaagctctacacc
tgctcagatagttccaaacagactgaggcagaatgcaagggtaactacatcacatacaaa
gatggggaggtcgatcaccccatcatccaaccccgtagctgggagaacagcaagtttgac
tttgacaacgttctggcggccatgatggccctctttaccgtctctacctttgagggatgg
ccagagctgctgtaccgctccatcgactcccacacagaagacaagggccccatctacaac
taccgtgtggagatctccatctttttcatcatctacatcatcatcattgccttcttcatg
atgaacatcttcgtgggtttcgtcatcgtcaccttccaggagcagggggagcaggaatac
aagaactgtgagctggacaagaaccagcgacaatgcgtggaatatgccctcaaggcccgg
cccctgcggaggtacatccccaagaaccagcaccagtacaaagtgtggtacgtggtcaac
tccacctactttgaatacctgatgttcgtcctcatccttctcaacaccatctgcttggcc
atgcagcactatggccaaagctgcctcttcaaaattgccatgaacatcctcaacatgctc
ttcactggcctcttcaccgtggagatgattctgaagctcattgccttcaaacccaagcac
tatttctgtgatgcatggaatacatttgacgccttgattgttgtgggtagcattgttgat
atagcaatcaccgaggtaaacccagctgaacatacccaatgctctccctttatgaacgca
gaggagaactcccgcatctccatcaccttcttccgcctcttccgggtcatgcgcctggtc
aagctgctgagccgaggggagggcatccggaccttgctgtggaccttcatcaagtccttc
caggccctgccctatgtggctcttctaatagtgatgctgttcttcatctacgcggtgatc
gggatgcaggtgtttgggaaaattgccctgaatgacaccacagagatcaatcggaacaac
aacttccagaccttcccccaagctgtgctgcttctcttcaggtgtgccacaggggaggca
tggcaggatatcatgctggcctgcatgccagggaagaagtgtgcccccgagtcggagccc
agcaacagcacagaaggtgaaacaccctgtggcagcagcttcgcggtcttctacttcatc
agcttctacatgctctgtgccttcctgatcatcaacctctttgtagctgtcatcatggac
aactttgactacctgacaagggactggtcaattcttggtccccatcatctggatgaattt
aaaagaatctgggcagagtatgatcctgaagccaagggtcgtatcaaacacctggacgta
gtgaccctgctccggcggattcagcccccactgggttttgggaagctatgccctcaccgc
gtggcttgcaaacgcctggtctccatgaacatgcctctgaacagtgatgggacagtcatg
ttcaatgctaccctgttcgccctggtccggacagccctgcggatcaaaacagaagcttct
cactctgagcaggggtcccaccccatgggtccctctggagtggatcctcaaggggctgat
gaccattttcagcctcatatctccctcccctcagggaacctagaacaagccaatgaggag
ctgcgggccataatcaagaagatctggaagcggaccagcatgaagctgctggaccaagtg
gtgcccccagcgggtgatgacgaggtcacagttggcaagttttatgctactttcctgatc
caagagtacttccggaaattcaagaagcgcaaagagcagggcctggtgggcaaaccctcc
cagaggaacgccctatccctgcaggctggcttgcgcacgctgcatgacatcgggcctgag
atccgacgggccatctctggagatctgacggctgaggaggagctggacaaggccatgaag
gaggctgtgtctgctgcctctgaagatgacatcttccggagggccggtggcctgttcggc
aaccacgtcagctactaccaaagtgacagccggaacgccttcccccagaccttcaccacc
cagcgcccactgcacatcaacaaggcggctaacagccaaggcgacaccgagtcgccatcc
cacgagaaactggtggactccactttcacccccagcagctactcatccactggctccaac
gccaacatcaacaatgccaacaacactgccctgggccgcttcccccgccccgctggttac
cccagcgcagtcagcaccgtggagggccacgggccccccttgtctcctgcagtccgggta
caggaggccgcatggaagctcagctccaagaggtgccactcccgggagagccagatcgcc
atggtgtgtcaggaggaagtctctcaggacgagacctatgaggtgaagctgagcgaggac
acagagtactgcagcgagcccagcctgatctccacagagctgatctcctatcaggatgat
gaaaaccggcaattaacaccgcctgaggaggacaggagagatatccggcaatctccaaag
aggggtttcctccgctctgcctcactaggtcgaagggcctccttccacctggaatgtcta
aagcgacagaagaatcaaggcggagacatctctcagaagacagtcctgcccttgcatctg
gttcatcatcaggcattggcagtggcgggcctgagccccctcctccagagaagccattcc
ccgagcacgttccccaggccgtgcgccacgcccccagccacacccggcagtcaaggctgg
cccccgcagccgatccccaccctgcggctggagggggccgagtccagcgagaaactcaac
agcagcttcccgtccatccactgcagctcctggtccggcgagcccgcgccctgcggtggg
ggcagcagcgccctgcggagagcccggccggtgtccctcactgtgcccagccaggctggg
gcccggggccggccgttctacggcagtgccagcagcctggtgggtgcggtcttgatttca
gaaggactggggcagtttgctcaagatcccaaatttatcgaggtcacaacccaggagctg
gctgacgcctgtgacatgaccatagaggagatggagaatgccgccgacaacatcctcagt
gggggcacccagcagagccccaacggcaccctactaccttttgttaactgcagggaccca
gggcaggacagagcggggggccaagagggcgagagctgcgccggggctcgggcgtgtcgg
aagagcgaggaggagcgccaggacagcagagcccacaccggcagcctgtag

DBGET integrated database retrieval system