KEGG   Enhydra lutris kenyoni (northern sea otter): 111159680
Entry
111159680         CDS       T05871                                 

Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 6
  KO
K05697  tyrosine-protein phosphatase non-receptor type 6 [EC:3.1.3.48]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04520  Adherens junction
elk04630  JAK-STAT signaling pathway
elk04650  Natural killer cell mediated cytotoxicity
elk04660  T cell receptor signaling pathway
elk04662  B cell receptor signaling pathway
elk05140  Leishmaniasis
elk05205  Proteoglycans in cancer
elk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111159680
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111159680
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111159680
   04660 T cell receptor signaling pathway
    111159680
   04662 B cell receptor signaling pathway
    111159680
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    111159680
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111159680
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    111159680
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:elk01009]
    111159680
Enzymes [BR:elk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     111159680
Protein phosphatases and associated proteins [BR:elk01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    111159680
SSDB
Motif
Pfam: Y_phosphatase SH2 DSPc Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 111159680
NCBI-ProteinID: XP_022377960
UniProt: A0A2Y9L924
LinkDB
Position
Unknown
AA seq 595 aa
MVRWFHRDLSGLDAETLLKGRGVHGSFLARPSRKNQGDFSLSVRVGDQVTHIRIQNSGDF
YDLYGGEKFATLTELVEYYTQQQGVLQDRDGTIIHLKYPLNCSDPTSERWYHGHMSGGQA
ETLLQAKGEPWTFLVRESLSQPGDFVLSVLSDQPKAGPGSPLRVTHIKVMCEGGRYTVGG
SETFDSLTDLVEHFKKTGIEEASGAFVYLRQPYYATRVNAADIENRVLELNKKQESEDTA
KAGFWEEFESLQKQEVKNLHQRLEGQRPENKSKNRYKNILPFDHTRVILQGRDSNIPGSD
YINANYVKNQLLGPDENTKTYIASQGCLEATVNDFWQMVWQENTRVIVMTTREVEKGRNK
CVPYWPEVGTQRVYGPYVVTNCREHDTAEYKLRTLHVSPLENGDLVREIWHYQYLSWPDH
GVPSEPGGVLSFLDQINQRQESLPQAGPIIVHCSAGIGRTGTIIVIDMLMESISTKGLDC
DIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEVMQSQKGRESEYGNIT
YPPAMKNAHAKASRTSSKHKEDVYENLHSKNKKEEKVKKQRSADKEKSKGSLKRK
NT seq 1788 nt   +upstreamnt  +downstreamnt
atggtgaggtggtttcaccgagacctcagcgggctggacgccgagaccctgctgaagggc
cgcggggtccacgggagcttcctggctcggcctagtcgcaagaaccagggggacttctcc
ctctccgtcagggtgggggatcaggtgacccatattcggatccagaactcgggcgatttc
tatgatctgtatggaggggagaagttcgcgacgctgacagagctcgtggagtactacacc
cagcagcagggtgtactgcaggaccgagacggcaccatcatccacctcaagtacccgctg
aactgctccgaccccaccagcgagaggtggtaccatggtcacatgtctggggggcaggca
gagacactgctgcaggccaagggggagccctggacattccttgtgcgtgagagtctcagc
cagcctggagattttgtactatctgtgctcagcgaccagcccaaggctggcccaggctcc
ccgctcagagtcactcatatcaaggtcatgtgtgagggtggacggtacactgtgggtggt
tcagagaccttcgacagtctcacagacctggtggagcatttcaagaagacagggatcgag
gaggcctcaggggcctttgtctacctgcggcagccatactatgccactcgggtgaatgcc
gcagacattgaaaatcgggtcttggaactcaacaagaagcaggagtcggaggacacagcc
aaagctggcttctgggaagagtttgagagtctgcagaagcaggaggtaaagaacttgcac
cagcggctagaagggcagaggccagagaacaagagcaagaaccgttacaagaacattctc
ccgtttgaccatacccgagtgatcctgcagggacgtgacagtaacatccctgggtccgac
tacatcaatgccaactatgtcaagaatcagctgctaggccccgatgagaacactaagacc
tacatcgccagccagggctgcctggaggccacggtcaatgacttctggcagatggtatgg
caggagaacacccgcgtcatcgtcatgaccacccgagaggtggagaagggccggaacaag
tgtgtcccatactggccagaggtgggcacacagcgcgtctacggaccctatgtggtcacc
aactgcagggaacacgacacagcggagtacaagctccggaccttacatgtctccccgctg
gagaatggggacctggttcgagagatctggcactaccagtacctgagctggcctgaccat
ggggtccccagtgagcctgggggtgtcctcagcttcctggaccagatcaaccagcggcag
gaaagtctgcctcaagcaggacccatcattgtacactgcagcgcaggcattggccgcacg
ggcaccatcattgtcatcgacatgctcatggagagcatctccaccaaggggttggactgt
gacattgacatccagaagaccatccagatggtgcgggctcagcgctcgggcatggtgcag
acagaggcacagtacaagttcatctatgtggccatcgcccagttcattgaaactaccaag
aagaagctggaggtcatgcagtcccagaagggccgggagtcagagtacgggaacatcacc
taccccccagccatgaagaatgcccatgccaaggcctcccgcacctcctccaaacacaag
gaggacgtatatgagaacttgcacagtaagaacaagaaggaggagaaggtgaagaagcag
aggtcggcagacaaggagaagagcaagggttcccttaagaggaagtga

DBGET integrated database retrieval system